Property Summary

NCBI Gene PubMed Count 127
PubMed Score 697.26
PubTator Score 305.05

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
interstitial lung disease 1.300 3.2e-02
psoriasis -2.600 7.5e-04
lung cancer -1.900 2.6e-05
interstitial cystitis 2.200 3.7e-03
lung adenocarcinoma -1.100 4.1e-05
aldosterone-producing adenoma -1.529 9.4e-03
lung carcinoma -2.500 2.5e-13
breast carcinoma -1.500 6.7e-13

Synonym

Accession O00585
Symbols ECL
SLC
CKb9
TCA4
6Ckine
SCYA21

Gene

PDB

2L4N  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (96)

PMID Text
26884842 CCL21/CCR7 induce VEGF-D up-regulation and promote lymphangiogenesis via ERK/Akt pathway in lung cancer.
26667143 Our findings suggested that MUC1 plays an important role in CCL21-CCR7-induced lymphatic metastasis and may serve as a therapeutic target in esophageal squamous cell carcinoma .
26320593 CCL21 gene SNP (rs951005) might confer genetic predisposition to polymyositis patients or such patients with interstitial lung disease in a Chinese Han population.
26146068 over-expression of CCL21 could increased the expressions of antigen presentation-related genes in CK8/18 TECs in MG patients
25961925 TGF-beta1 promoted CCL21 expression in lymphatic endothelial cells. CCL21 acted in a paracrine fashion to mediate chemotactic migration of EMT cells toward lymphatic endothelial cells.
25957582 increased expression in mononuclear inflammatory cells isolated from the brain during active stage of experimental autoimmune encephalomyelitis
25744065 These results reveal that CCR7 and VEGF-C display a significant crosstalk and suggest a novel role of the CCL21/CCR7 chemokine axis in the promotion of breast cancer-induced lymphangiogenesis.
25688986 HIV-1 gp120 enhances CCL-21-induced CD4+ T cell chemotaxis in a CXCR4- and CD4-dependent manner
25575049 CCL21 promotes the metastasis of pancreatic cancer via epithelial-mesenchymal transition.
25556164 CCL21/CCR7 pathway activates signallings to up-regulate Slug pathway, leading to the occurrence of epithelial-mesenchymal transition process in human chondrosarcoma
25473269 Modulation of the chemokines CCL19 and CCL21 represents a potent immunoregulatory treatment approach, and thus represents a novel therapeutic target to stabilize atherosclerotic lesions.
25398010 CCL21/CCR7 interactions might be involved in the response to pressure overload secondary to aortic stenosis.
25260647 CCL21 and CCL19 were significantly increased in serum from ankylosing spondylitis patients.
25142946 Studied expression of CCR7 and EMT markers in the primary breast carcinoma tissues from patients who underwent radical mastectomy. and investigated whether CCL21/CCR7 induces EMT process during mediating cancer cell invasion or migration in vitro.
24990231 CCL21 rs2812377 was associated with coronary artery disease in a Chinese Han population.
24945611 Priming by CCL21 restricts lateral mobility of the adhesion receptor LFA-1 and restores adhesion to ICAM-1 nanoaggregates on human mature dendritic cells.
24841666 CCL21 was shown to be involved in the induction of ulcerative colitis. Suppression of CCL21 expression decreased damage induced from ulcerative colitis, indicating that CCL21 targeted therapy might be an effective treatment for this disease
24556356 CCL21 expression was increased in hyperplastic myasthenia gravis thymuses.
24507453 Serum CCL19 and CCL21 were up-regulated during Rickettsia conorii infection.
24393484 overexpressed in myasthenia gravis thymus
24383579 these data suggested an important role of the lymphoid-endothelium-associated chemokine, CCL21, on dendritic cells in the induction of cytotoxic T lymphocytes responses.
24111618 Although CCL21 levels are elevated, no CCL21-positive cells are observed in patients with eosinophilic pneumonia.
24035972 In amnion epithelial cells exposed to zinc ferrite nanoparticles there is an increase in CCL21 activation; in situ nanoparticles induce oxidative stress, alterations in cellular membrane and DNA strand breaks.
23764550 Elevated serum CCL21 correlates with opsoclonus-myoclonus syndrome severity and duration in pediatric opsoclonus-myoclonus syndrome.
23760102 CCL21 expression was found to be an independent prognostic biomarker for CRC.
23498789 Results suggest that the CCL21/CCR7 signaling pathway is involved in renal fibrosis in kidney transplant patients.
22976543 Our findings would suggest that CCL19 and CCL21 may not be associated with cervical lymph node metastasis or other clinical and microscopic factors in oral squamous cell carcinoma.
22884357 CCL21 attenuates HSV-induced inflammation through up-regulation of CD8+ memory cells.
22619482 oxLDL induces an in vitro downregulation of CCR7 and CCL21, which may play a role in the reduction of dendritic cell migration from the plaques
22468089 These results suggest that overexpression of CCL21 and CCL7 is associated with tumor metastasis and serves as a prognostic factor in patients with gastric cancer.
22438908 CCL21/CCR7 prevents apoptosis by upregulating the expression of bcl-2 and by downregulating the expression of bax and caspase-3 potentially via the ERK pathway in non-small cell lung cancer cell lines
22427939 High serum levels of CCL21 are independently associated with mortality in chronic and acute post-myocardial infarction heart failure.
22392503 CCL21 is a mediator of rheumatoid arthritis angiogenesis.
22221265 CCL21 structure solved by nuclear magnetic resonance (NMR) contains a conserved chemokine domain followed by an extended, unstructured C-terminus that is not typical of most other chemokines.
21972019 CCL21 was more localized to chondrocytes and meniscal cells during the development of osteoarthritis in mice.
21698152 results suggest that CCL21/CCR7 contributes to the time-dependent proliferation of human NSCLC cells by upregulating cyclin A, cyclin B1, and CDK1 potentially via the ERK pathway
21666055 Overexpression of the chemokine CCL21 in the thyroids of CCL21 transgenic mice leads to formation of lymphoid aggregates containing topologically segregated T and B lymphocytes, dendritic cells, and specialized vasculature.
21594558 The chemotactic interaction between CCR7 and its ligand, CCL21, may be a critical event during progression in pancreatic cancer
21586211 The results obtained through a cohort of European Caucasian Systemic sclerosis patients do not support the implication of CCL21 gene in the pathogenesis of SSc but the gene were identified as Rheumatoid arthritis susceptibility gene.
21464944 These results suggest a new combinatorial guiding mechanism by CCL19 and CCL21 for the migration and trafficking of CCR7 expressing leukocytes.
20889506 the CCR7/CCL21 signaling pathway leading to T lymphocyte migration on fibronectin is a beta1 integrin-dependent pathway involving transient ERK1/2 phosphorylation, which is modulated by PLCgamma1
20797713 We found an association of CCL21 (rs2812378) and HLA-DRB1 (rs660895) with moderate to severe endometriosis
20797713 Observational study of gene-disease association. (HuGE Navigator)
20739459 These results imply a direct role for CCL21 in lymphatic transmigration that involves the selective use of integrin activation in inflammation.
20498205 Meta-analysis of gene-disease association. (HuGE Navigator)
20488940 Polysialyted NRP2 enhances dendritic cell migration of basic C-terminal ergion of CCL21.
20488224 Analysis of migratory and prosurvival pathways induced by the homeostatic chemokines CCL19 and CCL21 in B-cell chronic lymphocytic leukemia.
20461788 In patients with inflammatory polyarthritis carriage of 1 or more risk alleles of the CCL21 gene was associated with increased cardiovascular disease mortality, whereas carriage of 2 copies was associated with increased all-cause mortality.
20461788 Observational study of gene-disease association. (HuGE Navigator)
20444755 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20439292 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
20233754 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
20219786 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20049410 Observational study of gene-disease association. (HuGE Navigator)
19847900 Although CCL21 attracts both human T and B cells, it acts more strongly on naive pathogenic antibody-producing B cells.
19832038 Dendritic cell transfected with secondary lymphoid-tissue chemokine and/or interleukin-2 gene-enhanced cytotoxicity of T-lymphocyte in human bladder tumor cell S in vitro.
19750015 prolonged TLR4 engagement is required for the generation of polySia-expressing DCs that facilitate CCL21 capture and subsequent CCL21-directed migration
19674979 Observational study of gene-disease association. (HuGE Navigator)
19644859 Observational study of gene-disease association. (HuGE Navigator)
19624896 CCL21 enhances the invasive ability of SW480 cells, induces MMP-9 expression, and promotes the survival of SW480 cells.
19180477 Observational study of gene-disease association. (HuGE Navigator)
19110536 Observational study of gene-disease association. (HuGE Navigator)
19082456 Our study implied that lower level of CCL21 in colorectal cancer tissue supports the idea that cancer is related to immunodeficiency
18802075 Independent of arrestin 2 or arrestin 3 expression, CCR7/CCL21 internalize.
18794853 Meta-analysis and genome-wide association study of gene-disease association. (HuGE Navigator)
18757429 experiments performed to investigate the survival, adhesion, and metalloproteases secretion indicate that CXCL13 combined with CCL19 and CCL21 mainly affects the chemotaxis of Sezary syndrome cells
18354239 in salivary gland MALT lymphoma the lymphoid chemokines CXCL13 and CCL21 are directly implicated in the organization of ectopic reactive lymphoid tissue
17982129 the pattern of CCL21 production in SLOs is maintained during inflammation and that the phenotypic and functional properties of stromal cells, found in SLO T-cell areas, are reproduced at ectopic sites.
17949547 knee synovial fluid CCL 21 levels were found to be increased in Rheumatoid arthritis patients as compared to Behcets disease and osteoarthritis patients
17890452 CCL21 significantly increased B-cell chronic lymphocytic leukemia MMP-9 production
17881634 after HIV-1 infection of CCL19- or CCL21-treated CD4(+) T-cells, low-level HIV-1 production but high concentrations of integrated HIV-1 DNA, approaching that seen in mitogen-stimulated T-cell blasts, was observed
17495955 CXCL13 and CCL21 are expressed in ectopic lymphoid follicles in cutaneous lymphoproliferative disorders.
17474076 prostate-associated lymphoid aggregates, frequently below the epithelia, arranged in B cell follicles expressed CXCL13, and parafollicular T cell areas showed CCL21 expression.
17469160 The abundance of CD83+ plasmacytoid dendritic cells (DCs) in perivascular areas and the overexpression of CCL19 and CCL21 in perivascular cellular foci suggest plasmacytoid DCs are central to the muscle inflammation in juvenile dermatomyositis.
17460916 Results of electrophoresis of the purified SLC protein showed that the molecular weight was larger than the predicted molecular weight.
17331965 chemokine ligand 21 modulates the functional properties of idiopathic pulmonary fibrosis/usual interstitial pneumonia fibroblasts, but not normal fibroblasts
16904643 Despite sharing only 25% sequence identity with CCL19, the amino terminal hexapeptide of CCL21 is capable of performing an in vitro role similar to that of CCL19, resulting in G protein activation of the CCR7 receptor.
16887149 The CCL19,CCL21/CCR7 chemokine system is expressed in inflamed muscles of polymyositis and may be involved in the pathomechanism of polymyositis.
15972662 HIV-1 gp120 enhances CCL-21-induced CD4+ T cell chemotaxis in a CXCR4- and CD4-dependent manner
15934082 The acquisition of lymphoid features in periductal foci in Sjogrens syndrome is associated with the expression of CXCL13 and CCL21 within the infiltrate.
15863780 no CCL21 mRNA could be detected in high endothelial venules, whereas immunostaining revealed CCL21 protein
15674360 The CCL-21 chemokine migrated poorly towards the (GFP)-transduced umbilical cord blood (UCB) CD34+ cells.
15569314 Activation of CCR7 on mesangial cells by SLC/CCL21 enhances the degree and firmness of cell adhesion and increases cell spreading and the formation of cell-cell contacts
15073111 CCL21 chemokine has a role in regulating chemokine receptor CCR7 in malignant melanoma
14978072 Evidence is provided that human CCL21 is a functional ligand for endogenously expressed CXCR3 in human adult microglia.
14726633 CCL21, a constitutively expressed chemokine, is strongly upregulated in human lymphatic vessels during a Th1/Tc1 allergic inflammatory response.
14709406 expression of CCL21, and TLRs 2 and 4 is predominantly induced in the peripheral lymphatic endothelium of the small intestinal microcirculation
14667884 6Ckine may be a potential chemoattractant for endometrial NK cells.
14592837 monocyte-derived dendritic cell migration to CCL19 and CCL21 is dependent on phospholipase C and intracellular calcium flux but not on phosphatidylinositol-3 kinase
14517790 Expression of CCL21 during chronic hepatitis C is implicated in the recruitment of T lymphocytes and the organization of inflammatory lymphoid tissue and may promote fibrogenesis in the inflamed areas via activation of CCR7 on hepatic stellate cells
12949249 CCL21 is an antimicrobial protein with bacteriocidal activity against E. coli and S. aureus.
12707342 Most blood vessels in tissue samples from patients with rheumatoid arthritis and ulcerative colitis express CCL21, and many perivascular CD45RA+ naive T cells are found in these tissues, but not in psoriasis, where CCL21+ vessels are rare.
12651610 Cathepsin D specifically cleaves this protein that is expressed in human breast cancer.
12393730 CCL21 binding to CCR7 on primary lymphocytes brings about rapid Jak2 phosphorylation.
12393410 the expression of CCL21 but not CCL19 or 20 was highly induced in endothelial cells of T-cell autoimmune diseases
11929789 located in high endothelial venules in an appropriate location to induce transendothelial migration of CLL cells into lymph nodes

AA Sequence

MAQSLALSLLILVLAFGIPRTQGSDGGAQDCCLKYSQRKIPAKVVRSYRKQEPSLGCSIPAILFLPRKRS      1 - 70
QAELCADPKELWVQQLMQHLDKTPSPQKPAQGCRKDRGASKTGKKGKGSKGCKRTERSQTPKGP           71 - 134
//

Text Mined References (127)

PMID Year Title
26884842 2015 CCL21/CCR7 up-regulate vascular endothelial growth factor-D expression via ERK pathway in human non-small cell lung cancer cells.
26667143 2015 CCL21-CCR7 promotes the lymph node metastasis of esophageal squamous cell carcinoma by up-regulating MUC1.
26320593 A single-nucleotide polymorphism of CCL21 rs951005 T>C is associated with susceptibility of polymyositis and such patients with interstitial lung disease in a Chinese Han population.
26146068 2015 [Over-expression of CCL21 up-regulates the antigen presentation-related genes of CK8/18 positive thymic epithelial cells in patients with myasthenia gravis].
25961925 2016 TGF-?1-induced EMT promotes targeted migration of breast cancer cells through the lymphatic system by the activation of CCR7/CCL21-mediated chemotaxis.
25957582 2015 Central Nervous System and Peripheral Expression of CCL19, CCL21 and Their Receptor CCR7 in Experimental Model of Multiple Sclerosis.
25744065 2015 The role of CCL21/CCR7 chemokine axis in breast cancer-induced lymphangiogenesis.
25575049 2015 [CCL21 promotes the metastasis of human pancreatic cancer Panc-1 cells via epithelial- mesenchymal transition].
25556164 2015 Slug signaling is up-regulated by CCL21/CCR7 [corrected] to induce EMT in human chondrosarcoma.
25473269 2014 CCL19 and CCL21 modulate the inflammatory milieu in atherosclerotic lesions.
25398010 2014 The homeostatic chemokine CCL21 predicts mortality in aortic stenosis patients and modulates left ventricular remodeling.
25260647 2014 Increased CCL19 and CCL21 levels promote fibroblast ossification in ankylosing spondylitis hip ligament tissue.
25142946 2014 CCL21/CCR7 axis activating chemotaxis accompanied with epithelial-mesenchymal transition in human breast carcinoma.
24990231 2014 Contribution of homeostatic chemokines CCL19 and CCL21 and their receptor CCR7 to coronary artery disease.
24945611 2014 Priming by chemokines restricts lateral mobility of the adhesion receptor LFA-1 and restores adhesion to ICAM-1 nano-aggregates on human mature dendritic cells.
24841666 2014 Effect of secondary lymphoid tissue chemokine suppression on experimental ulcerative colitis in mice.
24556356 2014 Increased number of Hassall's corpuscles in myasthenia gravis patients with thymic hyperplasia.
24507453 2014 Increased expression of the homeostatic chemokines CCL19 and CCL21 in clinical and experimental Rickettsia conorii infection.
24393484 2014 Central role of interferon-beta in thymic events leading to myasthenia gravis.
24390342 2014 Genetics of rheumatoid arthritis contributes to biology and drug discovery.
24383579 2014 The lymphoid chemokine CCL21 enhances the cytotoxic T lymphocyte-inducing functions of dendritic cells.
24111618 2013 Elevated concentrations of CCR7 ligands in patients with eosinophilic pneumonia.
24035972 2013 Zinc ferrite nanoparticles activate IL-1b, NFKB1, CCL21 and NOS2 signaling to induce mitochondrial dependent intrinsic apoptotic pathway in WISH cells.
23764550 2013 CCR7 signaling in pediatric opsoclonus-myoclonus: upregulated serum CCL21 expression is steroid-responsive.
23760102 2013 CCL21 as an independent favorable prognostic factor for stage III/IV colorectal cancer.
23620790 2013 CBAP functions as a novel component in chemokine-induced ZAP70-mediated T-cell adhesion and migration.
23498789 2013 Distribution and expression of fibroblast-specific protein chemokine CCL21 and chemokine receptor CCR7 in renal allografts.
23341447 2013 ?-Arrestin recruitment and G protein signaling by the atypical human chemokine decoy receptor CCX-CKR.
22976543 2013 The expression of chemokines CCL19, CCL21 and their receptor CCR7 in oral squamous cell carcinoma and its relevance to cervical lymph node metastasis.
22884357 2013 CCL21 attenuates HSV-induced inflammation through up-regulation of CD8+ memory cells.
22619482 2012 oxLDL downregulates the dendritic cell homing factors CCR7 and CCL21.
22468089 2012 CCL7 and CCL21 overexpression in gastric cancer is associated with lymph node metastasis and poor prognosis.
22438908 2012 CCL21/CCR7 prevents apoptosis via the ERK pathway in human non-small cell lung cancer cells.
22427939 2012 The homeostatic chemokine CCL21 predicts mortality and may play a pathogenic role in heart failure.
22392503 2012 Role of the CCL21 and CCR7 pathways in rheumatoid arthritis angiogenesis.
22221265 2012 Solution structure of CCL21 and identification of a putative CCR7 binding site.
21972019 2012 Microarray analysis reveals age-related differences in gene expression during the development of osteoarthritis in mice.
21698152 2011 CCL21/CCR7 promotes G2/M phase progression via the ERK pathway in human non-small cell lung cancer cells.
21666055 2011 A critical role for dendritic cells in the formation of lymphatic vessels within tertiary lymphoid structures.
21594558 2011 The chemotactic interaction between CCL21 and its receptor, CCR7, facilitates the progression of pancreatic cancer via induction of angiogenesis and lymphangiogenesis.
21586211 Association study of 3 rheumatoid arthritis risk loci in systemic sclerosis in European Caucasian population.
21464944 2011 Combinatorial guidance by CCR7 ligands for T lymphocytes migration in co-existing chemokine fields.
21051556 2011 CCR7 is involved in the migration of neutrophils to lymph nodes.
20889506 2010 CCR7/CCL21 migration on fibronectin is mediated by phospholipase Cgamma1 and ERK1/2 in primary T lymphocytes.
20797713 2011 Endometriosis and autoimmune disease: association of susceptibility to moderate/severe endometriosis with CCL21 and HLA-DRB1.
20739459 2010 Inflammation-induced secretion of CCL21 in lymphatic endothelium is a key regulator of integrin-mediated dendritic cell transmigration.
20498205 2010 Investigation of potential non-HLA rheumatoid arthritis susceptibility loci in a European cohort increases the evidence for nine markers.
20488940 2010 Polysialylated neuropilin-2 enhances human dendritic cell migration through the basic C-terminal region of CCL21.
20488224 2010 Analysis of migratory and prosurvival pathways induced by the homeostatic chemokines CCL19 and CCL21 in B-cell chronic lymphocytic leukemia.
20461788 2010 Association of a rheumatoid arthritis susceptibility variant at the CCL21 locus with premature mortality in inflammatory polyarthritis patients.
20453842 2010 Genome-wide association study meta-analysis identifies seven new rheumatoid arthritis risk loci.
20444755 2010 Investigation of rheumatoid arthritis susceptibility genes identifies association of AFF3 and CD226 variants with response to anti-tumour necrosis factor treatment.
20439292 2010 Genetic variants in the prediction of rheumatoid arthritis.
20233754 2010 Cumulative association of 22 genetic variants with seropositive rheumatoid arthritis risk.
20219786 2011 The role of rheumatoid arthritis genetic susceptibility markers in the prediction of erosive disease in patients with early inflammatory polyarthritis: results from the Norfolk Arthritis Register.
20049410 2010 A functionally relevant IRF5 haplotype is associated with reduced risk to Wegener's granulomatosis.
19847900 2009 CCL21 overexpressed on lymphatic vessels drives thymic hyperplasia in myasthenia.
19832038 2009 Dendritic cell transfected with secondary lymphoid-tissue chemokine and/or interleukin-2 gene-enhanced cytotoxicity of T-lymphocyte in human bladder tumor cell S in vitro.
19750015 2009 Interaction of polysialic acid with CCL21 regulates the migratory capacity of human dendritic cells.
19674979 2010 Overlap of disease susceptibility loci for rheumatoid arthritis and juvenile idiopathic arthritis.
19644859 2009 Association of a single-nucleotide polymorphism in CD40 with the rate of joint destruction in rheumatoid arthritis.
19624896 2009 [Role of CCL21/CCR7 in invasion of colorectal carcinoma cell line SW480].
19180477 2009 Genetic risk factors for rheumatoid arthritis differ in Caucasian and Korean populations.
19110536 2009 Analysis of 17 autoimmune disease-associated variants in type 1 diabetes identifies 6q23/TNFAIP3 as a susceptibility locus.
19082456 2009 Decreased expression of the chemokine CCL21 in human colorectal adenocarcinomas.
18802075 2008 Arrestin 3 mediates endocytosis of CCR7 following ligation of CCL19 but not CCL21.
18794853 2008 Common variants at CD40 and other loci confer risk of rheumatoid arthritis.
18757429 2008 CXCL13 is highly produced by Sézary cells and enhances their migratory ability via a synergistic mechanism involving CCL19 and CCL21 chemokines.
18577758 2008 Dissociation of heterotrimeric g proteins in cells.
18354239 2008 CXCL13, CCL21, and CXCL12 expression in salivary glands of patients with Sjogren's syndrome and MALT lymphoma: association with reactive and malignant areas of lymphoid organization.
18308860 2008 CCL25 and CCL28 promote alpha4 beta7-integrin-dependent adhesion of lymphocytes to MAdCAM-1 under shear flow.
18240029 2008 Reviews in molecular biology and biotechnology: transmembrane signaling by G protein-coupled receptors.
17982129 2007 CCL21 expression pattern of human secondary lymphoid organ stroma is conserved in inflammatory lesions with lymphoid neogenesis.
17949547 Synovial lymphoid neogenetic factors in Behçet's synovitis: do they play a role in self-limiting and subacute course of arthritis?
17890452 2008 Matrix metalloproteinase-9 is up-regulated by CCL21/CCR7 interaction via extracellular signal-regulated kinase-1/2 signaling and is involved in CCL21-driven B-cell chronic lymphocytic leukemia cell invasion and migration.
17881634 2007 CCR7 ligands CCL19 and CCL21 increase permissiveness of resting memory CD4+ T cells to HIV-1 infection: a novel model of HIV-1 latency.
17495955 2007 CXCL13 and CCL21 are expressed in ectopic lymphoid follicles in cutaneous lymphoproliferative disorders.
17474076 2007 The prostate-associated lymphoid tissue (PALT) is linked to the expression of homing chemokines CXCL13 and CCL21.
17469160 2007 Plasmacytoid dendritic cells in inflamed muscle of patients with juvenile dermatomyositis.
17460916 2007 [Cloning and expression in Escherichia coli of secondary lymphoid-tissue chemokine (SLC) gene].
17331965 2007 Idiopathic pulmonary fibrosis fibroblasts migrate and proliferate to CC chemokine ligand 21.
16904643 2006 The N-terminal domain of CCL21 reconstitutes high affinity binding, G protein activation, and chemotactic activity, to the C-terminal domain of CCL19.
16887149 2006 Expression of CCR7 and its ligands CCL19/CCL21 in muscles of polymyositis.
16713569 2006 A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration.
16671092 2006 Chemokines and cancer.
15934082 2005 Association of CXCL13 and CCL21 expression with the progressive organization of lymphoid-like structures in Sjögren's syndrome.
15863780 2005 Disparate lymphoid chemokine expression in mice and men: no evidence of CCL21 synthesis by human high endothelial venules.
15778365 2005 The chemokine receptor CCR7 activates in dendritic cells two signaling modules that independently regulate chemotaxis and migratory speed.
15674360 2005 BCR/ABL-mediated downregulation of genes implicated in cell adhesion and motility leads to impaired migration toward CCR7 ligands CCL19 and CCL21 in primary BCR/ABL-positive cells.
15569314 2004 Binding of the chemokine SLC/CCL21 to its receptor CCR7 increases adhesive properties of human mesangial cells.
15546958 2005 A rich chemokine environment strongly enhances leukocyte migration and activities.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15461605 2004 Is secondary lymphoid-organ chemokine (SLC/CCL21) much more than a constitutive chemokine?
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
15073111 2004 CCL21 chemokine regulates chemokine receptor CCR7 bearing malignant melanoma cells.
15059845 2004 Chemokine receptor CCR7 induces intracellular signaling that inhibits apoptosis of mature dendritic cells.
14978072 2004 Cutting edge: activity of human adult microglia in response to CC chemokine ligand 21.
14726959 2004 Chemokine gene modification of human dendritic cell-based tumor vaccines using a recombinant adenoviral vector.
14726633 2004 Secondary lymphoid tissue chemokine (CCL21) is upregulated in allergic contact dermatitis.
14709406 2004 Expression of Toll-like receptors 2 and 4 on human intestinal lymphatic vessels.
14667884 2003 Fluctuation of 6Ckine expression in human endometrium during the menstrual cycle.
14592837 2004 CCL19/CCL21-triggered signal transduction and migration of dendritic cells requires prostaglandin E2.
14517790 2003 The chemokine CCL21 modulates lymphocyte recruitment and fibrosis in chronic hepatitis C.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12949249 2003 Many chemokines including CCL20/MIP-3alpha display antimicrobial activity.
12847218 2003 A high endothelial venule secretory protein, mac25/angiomodulin, interacts with multiple high endothelial venule-associated molecules including chemokines.
12729902 2003 Rho kinase is required for CCR7-mediated polarization and chemotaxis of T lymphocytes.
12707342 2003 Naive T cell recruitment to nonlymphoid tissues: a role for endothelium-expressed CC chemokine ligand 21 in autoimmune disease and lymphoid neogenesis.
12651610 2003 Cathepsin D specifically cleaves the chemokines macrophage inflammatory protein-1 alpha, macrophage inflammatory protein-1 beta, and SLC that are expressed in human breast cancer.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12393730 2003 CCR7-mediated physiological lymphocyte homing involves activation of a tyrosine kinase pathway.
12393410 2003 Endothelial induction of the T-cell chemokine CCL21 in T-cell autoimmune diseases.
12066416 2002 Neuronal SLC (CCL21) expression: implications for the neuron-microglial signaling system.
11970971 2002 Roles of SLC/CCL21 and CCR7 in human kidney for mesangial proliferation, migration, apoptosis, and tissue homeostasis.
11943728 2002 Hepatic expression of secondary lymphoid chemokine (CCL21) promotes the development of portal-associated lymphoid tissue in chronic inflammatory liver disease.
11929789 2002 The chemokine receptor CCR7 and alpha4 integrin are important for migration of chronic lymphocytic leukemia cells into lymph nodes.
11242036 2001 Involvement of chemokine receptors in breast cancer metastasis.
11083865 2001 Versican interacts with chemokines and modulates cellular responses.
10861057 2000 Macrophage-derived chemokine and EBI1-ligand chemokine attract human thymocytes in different stage of development and are produced by distinct subsets of medullary epithelial cells: possible implications for negative selection.
10706668 2000 Cutting edge: identification of a novel chemokine receptor that binds dendritic cell- and T cell-active chemokines including ELC, SLC, and TECK.
10201891 1999 Cutting edge: species specificity of the CC chemokine 6Ckine signaling through the CXC chemokine receptor CXCR3: human 6Ckine is not a ligand for the human or mouse CXCR3 receptors.
9585422 1998 6-C-kine (SLC), a lymphocyte adhesion-triggering chemokine expressed by high endothelium, is an agonist for the MIP-3beta receptor CCR7.
9507024 1998 Secondary lymphoid-tissue chemokine is a functional ligand for the CC chemokine receptor CCR7.
9419363 1998 A chemokine expressed in lymphoid high endothelial venules promotes the adhesion and chemotaxis of naive T lymphocytes.
9300671 1997 Isolation and characterization of Exodus-2, a novel C-C chemokine with a unique 37-amino acid carboxyl-terminal extension.
9257816 1997 Identification and characterization of a novel beta chemokine containing six conserved cysteines.
9235955 1997 Molecular cloning of a novel human CC chemokine secondary lymphoid-tissue chemokine that is a potent chemoattractant for lymphocytes and mapped to chromosome 9p13.