Property Summary

NCBI Gene PubMed Count 74
PubMed Score 231.56
PubTator Score 194.20

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Gene RIF (58)

PMID Text
26115234 The solution structure of CCL19 is reported. It contains a canonical chemokine domain. Chemical shift mapping shows the N-termini of PSGL-1 and CCR7 have overlapping binding sites for CCL19 and binding is competitive.
25704572 observed significantly higher concentrations of IL-8 (p < 0.001), MCP-1 (p = 0.014), and MIP-3beta (p = 0.022) in the PF of women with endometriosis than in the controls.
25656506 Our findings serve to elucidate the molecular mechanisms underlying the resistin induction of CCL19 expression in ECs and the shear-stress protection against this induction.
25636509 CrkL regulates CCL19 and CCR7-induced epithelial-to-mesenchymal transition via ERK signaling pathway in epithelial ovarian carcinoma patients.
25260647 The mRNA levels of CCL19/CCL21 in ankylosing spondylitis hip ligament were significantly higher than in osteoarthritis ligament.
25256673 The pathogenesis of human prostate cancer may be mediated by the CCL19/CCR7 axis.
25240755 The migration capacity of PLA-p24-loaded human monocyte-derived dendritic cells is significantly higher in the presence of CCL19 than in the absence of this chemokine
25225162 our data suggest that both CCL19 mRNA and protein were obviously expressed in a lower degree in HCC tissues than adjacent non-tumorous liver tissues. The proliferation and migration of cells were distinctly suppressed by CCL19.
24990231 CCL19 promoted monocyte adhesion to HUVEC cells. CCL19 rs2227302 was associated with coronary artery disease in a Chinese Han population.
24910430 The migration capacity of PLA-p24-loaded human monocyte-derived dendritic cells is significantly higher in the presence of CCL19 than in the absence of this chemokine
24507453 Serum CCL19 and CCL21 were up-regulated during Rickettsia conorii infection.
24111618 CCL19 (rather than CCL21) may contribute to the accumulation of dendritic cells and macrophages in the inflamed lungs of patients with eosinophilic pneumonia.
23922113 A high expression of CCL19 was a good prognostic factor of lung adenocarcinoma.
23898208 The migration capacity of PLA-p24-loaded human monocyte-derived dendritic cells is significantly higher in the presence of CCL19 than in the absence of this chemokine
23740460 Serum CCL19 measurement is a new hallmark of the B cell-mediated rheumatoid arthritis subtype and may predict clinical response to rituximab.
23644527 CIP4 is expressed at abnormally high levels in CLL cells, where it is required for CCL19-induced chemotaxis.
23071112 The migration capacity of PLA-p24-loaded human monocyte-derived dendritic cells is significantly higher in the presence of CCL19 than in the absence of this chemokine
22976543 Our findings would suggest that CCL19 and CCL21 may not be associated with cervical lymph node metastasis or other clinical and microscopic factors in oral squamous cell carcinoma.
22334704 a novel signaling pathway that controls EDG-1 up-regulation following stimulation of T cells by CCR7 and CCL19.
22288592 involvement of CCL19 in AIDS patients with advanced immunodeficiency, potentially mediating both adaptive and maladaptive responses
21464944 These results suggest a new combinatorial guiding mechanism by CCL19 and CCL21 for the migration and trafficking of CCR7 expressing leukocytes.
20969772 increased expression of MIP-3alpha favors recruitment of immature DCs to the tumour bed, whereas de novo local expression of SLC and MIP-3beta induces accumulation of mature DCs at the tumour margin forming clusters with T-cells
20942936 The migration capacity of PLA-p24-loaded human monocyte-derived dendritic cells is significantly higher in the presence of CCL19 than in the absence of this chemokine
20865789 Klebsiella pneumoniae-triggered DC recruit human NK cells in a CCR5-dependent manner leading to increased CCL19-responsiveness and activation of NK cells.
20592280 Nuclear localization of four and a half LIM domains 2 (FHL2) transgene is lost in mature but not immature bone marrow-derived dendritic cells following stimulation with CCL19.
20503287 Observational study of gene-disease association. (HuGE Navigator)
20237496 Observational study of gene-disease association. (HuGE Navigator)
20015995 The migration capacity of PLA-p24-loaded human monocyte-derived dendritic cells is significantly higher in the presence of CCL19 than in the absence of this chemokine
20002784 The CCL19 is known to be critically involved in lymphocyte and dendritic cell trafficking, CCL19-binding competition by CRAM might be involved in modulating these processes.
19655301 Results demonstrated that RelB/p50 was active only in DC expressing both RelB and p50, and induced CCL19 production, but not DC maturation.
19540558 macrophages may participate in lymphangiogenesis in diffuse alveolar damage, which is facilitated by CCL19 and CCR7.
19258923 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18838169 Complement C1q chemoattracts human dendritic cells and enhances migration of mature dendritic cells to CCL19 via activation of AKT and MAPK pathways.(
18757429 experiments performed to investigate the survival, adhesion, and metalloproteases secretion indicate that CXCL13 combined with CCL19 and CCL21 mainly affects the chemotaxis of Sezary syndrome cells
18310327 The migration capacity of PLA-p24-loaded human monocyte-derived dendritic cells is significantly higher in the presence of CCL19 than in the absence of this chemokine
18047937 CCL19, CCL20 and CCL22 factors could play an additive role in the pathogenesis of the inflammatory process leading to bronchiolar fibro-obliteration in lung transplant patients
17881634 after HIV-1 infection of CCL19- or CCL21-treated CD4(+) T-cells, low-level HIV-1 production but high concentrations of integrated HIV-1 DNA, approaching that seen in mitogen-stimulated T-cell blasts, was observed
17825430 This study suggests that CCL19 plays a role in both the physiological immunosurveillance of the healthy CNS and the pathological maintenance of immune cells in the CNS of MS patients.
17709502 CCL19 plus CXCL13 regulate interaction between B-ALL CD23+CD5+ B cells and CD8+ T cells by inducing activation of PEG10, in turn, resulting in IL-10 overexpression and impairment of tumor-specific cytotoxicity in syngeneic CD8+ T cells.
17703412 Observational study of gene-disease association. (HuGE Navigator)
17597826 These findings suggest hitherto unknown roles of SMAD transcription factors and of CCL19 in the elicitation phase of allergic contact dermatitis.
17469160 The abundance of CD83+ plasmacytoid dendritic cells (DCs) in perivascular areas and the overexpression of CCL19 and CCL21 in perivascular cellular foci suggest plasmacytoid DCs are central to the muscle inflammation in juvenile dermatomyositis.
17182562 Expression of the CCL19 gene is regulated by a combined action of several members of the NF-kappaB, IRF, and STAT family transcription factors.
17082584 CXCL13 and CCL19 cooperatively induce significant resistance to TNF-alpha-mediated apoptosis in acute and chronic B cell leukemia CD23+CD5+ B cells, but not in the cells from cord blood.
16904643 Despite sharing only 25% sequence identity with CCL21, the amino terminal hexapeptide of CCL19 is capable of performing an in vitro role similar to that of CCL21, resulting in G protein activation of the CCR7 receptor.
16887149 The CCL19,CCL21/CCR7 chemokine system is expressed in inflamed muscles of polymyositis and may be involved in the pathomechanism of polymyositis.
16500130 The maturation, in vitro migration and cytokine production of human DC after stimulation with live H. pylori is reported.
16249377 Nitric oxide (NO) donor NOR4 provides a signal allowing LPS-stimulated DCs to migrate toward CCL19.
16081805 By conditioning naive T cells into a motile dendritic cell-scanning state, CCL19 promotes antigen-independent responses and increases the probability of cognate histocompatibility complex (MHC)-peptide encounter.
15674360 The ccl19 migrated poorly towards the GFP UCB or normal (NL) BM CD34+ cells, p210 UCB and CML CD34+ cells.
15019823 MIP-3beta was expressed in the human endometrium, but our results could not strongly support the hypothesis that MIP-3beta is a potential chemoattractant for endometrial NK cells.
14871974 CCL19 and CXCL12 have roles in chemotaxis of mantle cell lymphoma B cells
14592837 migration to CCL19 and CCL21 is dependent on phospholipase C and intracellular calcium flux but not on phosphatidylinositol-3 kinase
12949249 CCL19 is an antimicrobial protein with bacteriocidal activity against E. coli.
11981810 Characterization of mouse CCX-CKR, a receptor for the lymphocyte-attracting chemokines TECK/mCCL25, SLC/mCCL21 and MIP-3beta/mCCL19: comparison to human CCX-CKR. (CCX-CKR)
11929789 located in high endothelial venules in an appropriate location to induce transendothelial migration of CLL cells into lymph nodes
11870628 Desensitizing concentrations of CCL21 and CCL19 had no significant effects on T lymphocyte transendothelial migration.
11869682 CC chemokine CCL19 attracts mature T cells out of the fetal thymus organ culture.

AA Sequence

MALLLALSLLVLWTSPAPTLSGTNDAEDCCLSVTQKPIPGYIVRNFHYLLIKDGCRVPAVVFTTLRGRQL      1 - 70
CAPPDQPWVERIIQRLQRTSAKMKRRSS                                               71 - 98
//

Text Mined References (74)

PMID Year Title
26115234 2015 Solution Structure of CCL19 and Identification of Overlapping CCR7 and PSGL-1 Binding Sites.
25754930 2015 Up-regulation of galectin-9 induces cell migration in human dendritic cells infected with dengue virus.
25704572 2015 Addition of MCP-1 and MIP-3? to the IL-8 appraisal in peritoneal fluid enhances the probability of identifying women with endometriosis.
25656506 2015 Shear Stress Modulates Resistin-Induced CC Chemokine Ligand 19 Expression in Human Aortic Endothelial Cells.
25636509 2015 Crk-like adapter protein regulates CCL19/CCR7-mediated epithelial-to-mesenchymal transition via ERK signaling pathway in epithelial ovarian carcinomas.
25260647 2014 Increased CCL19 and CCL21 levels promote fibroblast ossification in ankylosing spondylitis hip ligament tissue.
25256673 2015 The effect of CCL19/CCR7 on the proliferation and migration of cell in prostate cancer.
25225162 2014 The effect of chemokine CC motif ligand 19 on the proliferation and migration of hepatocellular carcinoma.
24990231 2014 Contribution of homeostatic chemokines CCL19 and CCL21 and their receptor CCR7 to coronary artery disease.
24507453 2014 Increased expression of the homeostatic chemokines CCL19 and CCL21 in clinical and experimental Rickettsia conorii infection.
24390342 2014 Genetics of rheumatoid arthritis contributes to biology and drug discovery.
24111618 2013 Elevated concentrations of CCR7 ligands in patients with eosinophilic pneumonia.
23922113 2013 High CC chemokine receptor 7 expression improves postoperative prognosis of lung adenocarcinoma patients.
23740460 2013 CCL19, a B cell chemokine, is related to the decrease of blood memory B cells and predicts the clinical response to rituximab in patients with rheumatoid arthritis.
23644527 2013 CIP4 controls CCL19-driven cell steering and chemotaxis in chronic lymphocytic leukemia.
23341447 2013 ?-Arrestin recruitment and G protein signaling by the atypical human chemokine decoy receptor CCX-CKR.
22976543 2013 The expression of chemokines CCL19, CCL21 and their receptor CCR7 in oral squamous cell carcinoma and its relevance to cervical lymph node metastasis.
22334704 2012 CCR7/CCL19 controls expression of EDG-1 in T cells.
22288592 2012 Enhanced levels of CCL19 in patients with advanced acquired immune deficiency syndrome (AIDS).
21464944 2011 Combinatorial guidance by CCR7 ligands for T lymphocytes migration in co-existing chemokine fields.
21051556 2011 CCR7 is involved in the migration of neutrophils to lymph nodes.
20969772 2010 Chemokine-mediated distribution of dendritic cell subsets in renal cell carcinoma.
20865789 2010 Klebsiella pneumoniae-triggered DC recruit human NK cells in a CCR5-dependent manner leading to increased CCL19-responsiveness and activation of NK cells.
20592280 2010 Four-and-a-half LIM domain protein 2 is a novel regulator of sphingosine 1-phosphate receptor 1 in CCL19-induced dendritic cell migration.
20503287 2010 Interleukin-9 polymorphism in infants with respiratory syncytial virus infection: an opposite effect in boys and girls.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
20002784 2010 CCL19 is a specific ligand of the constitutively recycling atypical human chemokine receptor CRAM-B.
19655301 2009 RelB/p50 regulates CCL19 production, but fails to promote human DC maturation.
19540558 2009 Macrophages participate in lymphangiogenesis in idiopathic diffuse alveolar damage through CCL19-CCR7 signal.
19258923 2009 Genetic susceptibility to respiratory syncytial virus bronchiolitis in preterm children is associated with airway remodeling genes and innate immune genes.
18838169 2008 Complement C1q chemoattracts human dendritic cells and enhances migration of mature dendritic cells to CCL19 via activation of AKT and MAPK pathways.
18757429 2008 CXCL13 is highly produced by Sézary cells and enhances their migratory ability via a synergistic mechanism involving CCL19 and CCL21 chemokines.
18577758 2008 Dissociation of heterotrimeric g proteins in cells.
18240029 2008 Reviews in molecular biology and biotechnology: transmembrane signaling by G protein-coupled receptors.
18047937 2008 Chemokine redundancy in BOS pathogenesis. A possible role also for the CC chemokines: MIP3-beta, MIP3-alpha, MDC and their specific receptors.
17881634 2007 CCR7 ligands CCL19 and CCL21 increase permissiveness of resting memory CD4+ T cells to HIV-1 infection: a novel model of HIV-1 latency.
17825430 2007 CCL19 is constitutively expressed in the CNS, up-regulated in neuroinflammation, active and also inactive multiple sclerosis lesions.
17709502 2007 CCL19 and CXCL13 synergistically regulate interaction between B cell acute lymphocytic leukemia CD23+CD5+ B Cells and CD8+ T cells.
17703412 2007 Genetic susceptibility to respiratory syncytial virus bronchiolitis is predominantly associated with innate immune genes.
17597826 2007 Gene expression time course in the human skin during elicitation of allergic contact dermatitis.
17469160 2007 Plasmacytoid dendritic cells in inflamed muscle of patients with juvenile dermatomyositis.
17182562 2007 Multiple NF-kappaB and IFN regulatory factor family transcription factors regulate CCL19 gene expression in human monocyte-derived dendritic cells.
17082584 2006 CXC chemokine ligand 13 and CC chemokine ligand 19 cooperatively render resistance to apoptosis in B cell lineage acute and chronic lymphocytic leukemia CD23+CD5+ B cells.
16904643 2006 The N-terminal domain of CCL21 reconstitutes high affinity binding, G protein activation, and chemotactic activity, to the C-terminal domain of CCL19.
16887149 2006 Expression of CCR7 and its ligands CCL19/CCL21 in muscles of polymyositis.
16678487 2006 Fine-tuning leukocyte responses: towards a chemokine 'interactome'.
16500130 2006 Dendritic cells express CCR7 and migrate in response to CCL19 (MIP-3beta) after exposure to Helicobacter pylori.
16249377 2006 Nitric oxide and cGMP protein kinase (cGK) regulate dendritic-cell migration toward the lymph-node-directing chemokine CCL19.
16081805 2005 CC chemokine ligand 19 secreted by mature dendritic cells increases naive T cell scanning behavior and their response to rare cognate antigen.
15778365 2005 The chemokine receptor CCR7 activates in dendritic cells two signaling modules that independently regulate chemotaxis and migratory speed.
15714581 2005 CCL22-induced responses are powerfully enhanced by synergy inducing chemokines via CCR4: evidence for the involvement of first beta-strand of chemokine.
15674360 2005 BCR/ABL-mediated downregulation of genes implicated in cell adhesion and motility leads to impaired migration toward CCR7 ligands CCL19 and CCL21 in primary BCR/ABL-positive cells.
15546958 2005 A rich chemokine environment strongly enhances leukocyte migration and activities.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15059845 2004 Chemokine receptor CCR7 induces intracellular signaling that inhibits apoptosis of mature dendritic cells.
15019823 2004 Expression of macrophage inflammatory protein-3beta in human endometrium throughout the menstrual cycle.
14871974 2004 CCL19 and CXCL12 trigger in vitro chemotaxis of human mantle cell lymphoma B cells.
14592837 2004 CCL19/CCL21-triggered signal transduction and migration of dendritic cells requires prostaglandin E2.
12949249 2003 Many chemokines including CCL20/MIP-3alpha display antimicrobial activity.
12729902 2003 Rho kinase is required for CCR7-mediated polarization and chemotaxis of T lymphocytes.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12474232 2003 Differential expression of CCL19 by DC-Lamp+ mature dendritic cells in human lymph node versus chronically inflamed skin.
11994492 2002 Anatomic localization of immature and mature dendritic cells in an ectopic lymphoid organ: correlation with selective chemokine expression in rheumatoid synovium.
11981810 2002 Characterization of mouse CCX-CKR, a receptor for the lymphocyte-attracting chemokines TECK/mCCL25, SLC/mCCL21 and MIP-3beta/mCCL19: comparison to human CCX-CKR.
11929789 2002 The chemokine receptor CCR7 and alpha4 integrin are important for migration of chronic lymphocytic leukemia cells into lymph nodes.
11870628 2002 Activation of pertussis toxin-sensitive CXCL12 (SDF-1) receptors mediates transendothelial migration of T lymphocytes across lymph node high endothelial cells.
11869682 2002 Role for CCR7 ligands in the emigration of newly generated T lymphocytes from the neonatal thymus.
10861057 2000 Macrophage-derived chemokine and EBI1-ligand chemokine attract human thymocytes in different stage of development and are produced by distinct subsets of medullary epithelial cells: possible implications for negative selection.
10706668 2000 Cutting edge: identification of a novel chemokine receptor that binds dendritic cell- and T cell-active chemokines including ELC, SLC, and TECK.
9743376 1998 EBI1/CCR7 is a new member of dendritic cell chemokine receptor that is up-regulated upon maturation.
9498785 1998 CK beta-11/macrophage inflammatory protein-3 beta/EBI1-ligand chemokine is an efficacious chemoattractant for T and B cells.
9235955 1997 Molecular cloning of a novel human CC chemokine secondary lymphoid-tissue chemokine that is a potent chemoattractant for lymphocytes and mapped to chromosome 9p13.
9153236 1997 Molecular cloning of a novel human CC chemokine EBI1-ligand chemokine that is a specific functional ligand for EBI1, CCR7.
9013939 1997 Identification through bioinformatics of two new macrophage proinflammatory human chemokines: MIP-3alpha and MIP-3beta.