1. Home
  2. Targets
  3. signaling molecule
  4. cytokine
  5. chemokine
  6. C-C motif chemokine 16

Tbio C-C motif chemokine 16

Shows chemotactic activity for lymphocytes and monocytes but not neutrophils. Also shows potent myelosuppressive activity, suppresses proliferation of myeloid progenitor cells. Recombinant SCYA16 shows chemotactic activity for monocytes and THP-1 monocytes, but not for resting lymphocytes and neutrophils. Induces a calcium flux in THP-1 cells that were desensitized by prior expression to RANTES.

This gene is one of several cytokine genes clustered on the q-arm of chromosome 17. Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes. The CC cytokines are proteins characterized by two adjacent cysteines. The cytokine encoded by this gene displays chemotactic activity for lymphocytes and monocytes but not for neutrophils. This cytokine also shows a potent myelosuppressive activity and suppresses proliferation of myeloid progenitor cells. The expression of this gene is upregulated by IL-10. [provided by RefSeq, Jul 2008]

 Comments

Property Summary

NCBI Gene PubMed Count 32
PubMed Score 252.25
PubTator Score 141.25

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
ovarian cancer 8491 1.2e-07
osteosarcoma 7933 1.8e-07

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma -2.639 1.8e-07
ovarian cancer 1.100 1.2e-07

Synonym

Accession O15467 Q4KKU0
Symbols LEC
LMC
NCC4
CKb12
HCC-4
LCC-1
Mtn-1
NCC-4
SCYL4
ILINCK
SCYA16

Gene

CCL16

PANTHER Protein Class (3)

  Ortholog (1)

Species Source Disease
Dog OMA Inparanoid

 UniProt Keyword (9)

 GO Function (3)

 GO Component (2)

 GO Process (15)

See all...

 Compartment GO Term (5)

 HCA RNA Cell Line (20)

See all...

Pathway (10)

Protein-protein Interaction (78)

GNAT3   CCL21   CXCL11   CCL25   CXCL13   S1PR2   S1PR4   PPBP   CXCL10   APP   SAA1   ADORA3   CXCL8   ADRA2C   CXCR5   CCR2   CXCL5   CXCL12   CXCR3   CCR9   CCL23   TAS2R38   TAS2R39   TAS2R40   TAS2R41   TAS2R43   TAS2R31   TAS2R45   TAS2R46   TAS2R30   TAS2R19   TAS2R20   TAS2R50   TAS2R60   GNG2   CXCR4   CCL20   CXCL6   CXCL9   NMS   PIK3R6   TAS2R42   MT-RNR2   NPW   NPB   HCAR2   OXER1   RXFP4   RLN3   PIK3R5   ARHGEF1   MCHR2   OXGR1   CCL19   P2RY13   SUCNR1   HCAR1   NMUR2   LPAR5   S1PR5   CXCL16   NMUR1   CCL28   HEBP1   TAS2R16   TAS2R14   TAS2R13   TAS2R10   TAS2R9   TAS2R8   TAS2R7   TAS2R5   TAS2R4   TAS2R3   TAS2R1   ARHGEF12   GPR55   CCL27  

Gene RIF (13)

PMID Text
22857868 High umbilical artery CCL16 is prominently detected in preterm preeclamptic pregnancies with severe growth restriction.
21951809 Data show that CCL-16 gene expression was upregulated by 7.46-fold in IBS patients when compared with controls and suggest a subclinical inflammatory component underlying IBS.
21288736 Low umbilical cord blood chemokine CCL16 associates with spontaneous preterm birth
20503287 Observational study of gene-disease association. (HuGE Navigator)
20237496 Observational study of gene-disease association. (HuGE Navigator)
19494526 Elevated concentrations in bronchoalveolar lavage fluid from patients with eosinophilic pneumonia
19258923 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17703412 Observational study of gene-disease association. (HuGE Navigator)
17122780 Observational study of gene-disease association. (HuGE Navigator)
16226254 CC chemokine-4 (HCC-4)/CCL16 transduces signals differently from other CCR1-dependent chemokines and may play different roles in the immune response.
15265943 CCL16 induced efficient migratory responses in human and mouse eosinophils. CCL16 is a novel functional ligand for H4 and may have a role in trafficking of eosinophils.
15034014 An adenoviral vector encoding human CCL16 injected into mice with pre-established mammary carcinoma induces strong antitumor response; when given before surgical excision of primary lesions, the treatment prevents metastatic spread and cures 63% of mice.
14525962 Recombinant CCL16 significantly enhances the effector and the antigen-presenting function of macrophages and augments T cell lytic activity.

AA Sequence 

MKVSEAALSLLVLILIITSASRSQPKVPEWVNTPSTCCLKYYEKVLPRRLVVGYRKALNCHLPAIIFVTK      1 - 70
RNREVCTNPNDDWVQEYIKDPNLPLLPTRNLSTVKIITAKNGQPQLLNSQ                         71 - 120
//

Text Mined References (32)

PMID Year Title
23954997 2013 Expression pattern of serum cytokines in hepatitis B virus infected patients with persistently normal alanine aminotransferase levels.
23922012 2014 Therapeutic immunization and local low-dose tumor irradiation, a reinforcing combination.
23602049 2013 The role of inflammatory chemokines in lymphoid neoorganogenesis in breast cancer.
22857868 2012 Umbilical artery chemokine CCL16 is associated with preterm preeclampsia and fetal growth restriction.
22147696 2012 Biochemical analysis of matrix metalloproteinase activation of chemokines CCL15 and CCL23 and increased glycosaminoglycan binding of CCL16.
21951809 2011 Pro-inflammatory chemokine C-C motif ligand 16 (CCL-16) dysregulation in irritable bowel syndrome (IBS): a pilot study.
21288736 2011 Cord blood chemokines differentiate between spontaneous and elective preterm births in singleton pregnancies.
20503287 2010 Interleukin-9 polymorphism in infants with respiratory syncytial virus infection: an opposite effect in boys and girls.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
19494526 2009 Elevated concentrations of liver-expressed chemokine/CC chemokine ligand 16 in bronchoalveolar lavage fluid from patients with eosinophilic pneumonia.
19258923 2009 Genetic susceptibility to respiratory syncytial virus bronchiolitis in preterm children is associated with airway remodeling genes and innate immune genes.
18577758 2008 Dissociation of heterotrimeric g proteins in cells.
18240029 2008 Reviews in molecular biology and biotechnology: transmembrane signaling by G protein-coupled receptors.
17703412 2007 Genetic susceptibility to respiratory syncytial virus bronchiolitis is predominantly associated with innate immune genes.
17122780 2007 Genome-wide scan for visceral leishmaniasis susceptibility genes in Brazil.
16226254 2005 Differential CCR1-mediated chemotaxis signaling induced by human CC chemokine HCC-4/CCL16 in HOS cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15265943 2004 Liver-expressed chemokine/CC chemokine ligand 16 attracts eosinophils by interacting with histamine H4 receptor.
15034014 2004 Intralesional injection of adenovirus encoding CC chemokine ligand 16 inhibits mammary tumor growth and prevents metastatic-induced death after surgical removal of the treated primary tumor.
15001559 2004 Human LZIP binds to CCR1 and differentially affects the chemotactic activities of CCR1-dependent chemokines.
14525962 2004 CCL16/LEC powerfully triggers effector and antigen-presenting functions of macrophages and enhances T cell cytotoxicity.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11470772 2001 Human CC chemokine liver-expressed chemokine/CCL16 is a functional ligand for CCR1, CCR2 and CCR5, and constitutively expressed by hepatocytes.
10910894 2000 LEC induces chemotaxis and adhesion by interacting with CCR1 and CCR8.
10671294 2000 Cloning, characterization and genomic organization of LCC-1 (scya16), a novel human CC chemokine expressed in liver.
10235110 1999 Genomic organization of the genes for human and mouse CC chemokine LEC.
10213461 1999 Organization of the chemokine gene cluster on human chromosome 17q11.2 containing the genes for CC chemokine MPIF-1, HCC-2, HCC-1, LEC, and RANTES.
9642106 1998 Isolation and characterization of LMC, a novel lymphocyte and monocyte chemoattractant human CC chemokine, with myelosuppressive activity.
9596672 1998 Characterization of a novel CC chemokine, HCC-4, whose expression is increased by interleukin-10.
9545580 1998 Isolation of cDNA encoding a novel human CC chemokine NCC-4/LEC.
8661057 1996 A YAC contig of the human CC chemokine genes clustered on chromosome 17q11.2.
2834384 1988 Presence of three distinct molecular species of Gi protein alpha subunit. Structure of rat cDNAs and human genomic DNAs.