Property Summary

NCBI Gene PubMed Count 49
PubMed Score 66.51
PubTator Score 20.06

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
hepatocellular carcinoma 550 4.323 2.2

Gene RIF (24)

PMID Text
26875556 follicular thyroid carcinoma (FTC) might induce tumor associated macrophages (TAMs) infiltration by producing CCL15. Measurement of TAMs and CCL15 in follicular thyroid lesions may be applied clinically to differentiate FTC from follicular adenoma
26341919 Loss of SMAD4 was significantly associated with CCL15 expression.
25579056 two inflammatory cytokines, MIP-1delta and MIP-3alpha, are able to increase mesenchymal stromal cells migration in vitro
23690481 we investigated a role of CCL15 in upregulating ICAM-1 in endothelial cells
23383108 A synthetic peptide corresponding to the immunosuppressive domain (amino acids 574-592) of HIV-1 gp41 upregulates the expression of chemokine (C-C motif) ligand 15 (CCL15) in peptide-treated PBMCs
22279551 Data show that Only three of these proteins EGF, PDGF-BB and MIP-1delta (CCL15) differed significantly in plasma between controls and Alzheimer's disease (AD).
22092970 CCL15 is elevated in human asthma and correlates with disease severity .
20503287 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20237496 Observational study of gene-disease association. (HuGE Navigator)
20016943 increased secretion by macrophages during Mycobacterium tuberculosis infection
19812544 enhanced expression in intestinal epithelium in inflammatory bowel disease and display of antibacterial activity
19669929 PKCdelta activation due to Lkn-1 is involved in migration, as well as the butyric acid-induced differentiation.
19258923 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17703412 Observational study of gene-disease association. (HuGE Navigator)
17296613 factor NF-kappaB plays an important role in regulation of LZIP expression, and LZIP expression regulates the monocyte cell migration induced by Lkn-1
16737685 Results point to an involvement of the CCL15-CCR1 axis in the pathophysiology of chronic renal failure.
16364464 Transcription of the CCL15 gene is regulated by AP-1 and NF-kappaB through MEK and JNK MAPK pathways in monocytoid cells.
16034099 Compared with full-length CCL15, proteolytically processed CCL15 isoforms with N-terminal deletions display increased potency to induce calcium fluxes and chemotactic activity on monocytes and to induce adhesiveness of mononuclear cells to fibronectin.
15894113 alanine-aspartic acid residues preceding the first cysteine at the NH(2)-terminus are essential for the binding and biological activity of leukotactin-1
15251437 CCL15(25-92) has in vitro and in vivo angiogenic activity
15179048 These observations demonstrate that the two NF-kappaB binding sites are essential for phorbol myristate acetate-induced leukotactin-1 (Lkn-1)/CCL15 expression in human monocytes.
12759139 Lkn-1 activates the ERK pathway by transducing the signal through G(i)/G(o) protein, PLC, PKC delta and Ras, and it may play a role for cell proliferation, differentiation, and regulation of gene expression for other cellular processes
11832479 truncation of NH2-terminal amino acid residues increases agonistic potency on CC chemokine receptors 1 and 3

AA Sequence

MKVSVAALSCLMLVAVLGSQAQFINDAETELMMSKLPLENPVVLNSFHFAADCCTSYISQSIPCSLMKSY      1 - 70
FETSSECSKPGVIFLTKKGRQVCAKPSGPGVQDCMKKLKPYSI                                71 - 113
//

Text Mined References (50)

PMID Year Title
26875556 2016 Follicular thyroid carcinoma but not adenoma recruits tumor-associated macrophages by releasing CCL15.
26341919 2016 Loss of SMAD4 Promotes Colorectal Cancer Progression by Accumulation of Myeloid-Derived Suppressor Cells through the CCL15-CCR1 Chemokine Axis.
25579056 2015 Inflammatory Chemokines MIP-1? and MIP-3? Are Involved in the Migration of Multipotent Mesenchymal Stromal Cells Induced by Hepatoma Cells.
23690481 2013 Enhancement of CCL15 expression and monocyte adhesion to endothelial cells (ECs) after hypoxia/reoxygenation and induction of ICAM-1 expression by CCL15 via the JAK2/STAT3 pathway in ECs.
22279551 2012 Evaluation of a previously suggested plasma biomarker panel to identify Alzheimer's disease.
22147696 2012 Biochemical analysis of matrix metalloproteinase activation of chemokines CCL15 and CCL23 and increased glycosaminoglycan binding of CCL16.
22092970 2012 Expression and regulation of CCL15 by human airway smooth muscle cells.
20616008 2010 Inactivation of chemokine (C-C motif) receptor 1 (CCR1) suppresses colon cancer liver metastasis by blocking accumulation of immature myeloid cells in a mouse model.
20503287 2010 Interleukin-9 polymorphism in infants with respiratory syncytial virus infection: an opposite effect in boys and girls.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
20126378 2008 Chemokine Lkn-1/CCL15 enhances matrix metalloproteinase-9 release from human macrophages and macrophage-derived foam cells.
20016943 2010 Mycobacterium tuberculosis-induced expression of Leukotactin-1 is mediated by the PI3-K/PDK1/Akt signaling pathway.
19812544 2010 A novel role for constitutively expressed epithelial-derived chemokines as antibacterial peptides in the intestinal mucosa.
19669929 2010 Leukotactin-1/CCL15 induces cell migration and differentiation of human eosinophilic leukemia EoL-1 cells through PKCdelta activation.
19258923 2009 Genetic susceptibility to respiratory syncytial virus bronchiolitis in preterm children is associated with airway remodeling genes and innate immune genes.
19220835 2009 Protein levels of CC chemokine ligand (CCL)15, CCL16 and macrophage stimulating protein in patients with sarcoidosis.
19203252 2009 CCL26-targeted siRNA treatment of alveolar type II cells decreases expression of CCR3-binding chemokines and reduces eosinophil migration: implications in asthma therapy.
18587271 2008 Human LZIP induces monocyte CC chemokine receptor 2 expression leading to enhancement of monocyte chemoattractant protein 1/CCL2-induced cell migration.
17703412 2007 Genetic susceptibility to respiratory syncytial virus bronchiolitis is predominantly associated with innate immune genes.
17296613 2007 Regulation of human LZIP expression by NF-kappaB and its involvement in monocyte cell migration induced by Lkn-1.
16737685 2006 Increase of expression and activation of chemokine CCL15 in chronic renal failure.
16364464 2005 Transcriptional regulation of human CC chemokine CCL15 gene by NF-kappaB and AP-1 elements in PMA-stimulated U937 monocytoid cells.
16341674 2005 Transcriptome analysis of human gastric cancer.
16034099 2005 Quantum proteolytic activation of chemokine CCL15 by neutrophil granulocytes modulates mononuclear cell adhesiveness.
15905581 2005 Proteolytic activation of alternative CCR1 ligands in inflammation.
15894113 2005 Identification of NH(2)-terminal amino acid residues essential for the biological activity of leukotactin-1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15340161 2004 Signal peptide prediction based on analysis of experimentally verified cleavage sites.
15251437 2004 Angiogenic activity of human CC chemokine CCL15 in vitro and in vivo.
15179048 2004 Involvement of two NF-kappaB binding sites in PMA-induced expression of the human leukotactin-1/CCL15 gene in U937 monocytoid cells.
15001559 2004 Human LZIP binds to CCR1 and differentially affects the chemotactic activities of CCR1-dependent chemokines.
14984572 2004 Functional analysis of chemically synthesized derivatives of the human CC chemokine CCL15/HCC-2, a high affinity CCR1 ligand.
12759139 2003 Leukotactin-1-induced ERK activation is mediated via Gi/Go protein/PLC/PKC delta/Ras cascades in HOS cells.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11943214 2002 Leukotactin-1/CCL15-induced chemotaxis signaling through CCR1 in HOS cells.
11888507 2002 A novel chemokine, Leukotactin-1, induces chemotaxis, pro-atherogenic cytokines, and tissue factor expression in atherosclerosis.
11832479 2002 Truncation of NH2-terminal amino acid residues increases agonistic potency of leukotactin-1 on CC chemokine receptors 1 and 3.
11527984 2001 Hemofiltrate CC chemokines with unique biochemical properties: HCC-1/CCL14a and HCC-2/CCL15.
10604595 1999 Synthesis and characterization of the human CC chemokine HCC-2.
10320325 1999 Solution structure of the human CC chemokine 2: A monomeric representative of the CC chemokine subtype.
10213461 1999 Organization of the chemokine gene cluster on human chromosome 17q11.2 containing the genes for CC chemokine MPIF-1, HCC-2, HCC-1, LEC, and RANTES.
10202040 1999 Differential effects of leukotactin-1 and macrophage inflammatory protein-1 alpha on neutrophils mediated by CCR1.
9624581 1998 Molecular cloning and functional characterization of human MIP-1 delta, a new C-C chemokine related to mouse CCF-18 and C10.
9600961 1998 HCC-2, a human chemokine: gene structure, expression pattern, and biological activity.
9558365 1998 Characterization of CKbeta8 and CKbeta8-1: two alternatively spliced forms of human beta-chemokine, chemoattractants for neutrophils, monocytes, and lymphocytes, and potent agonists at CC chemokine receptor 1.
9548457 1997 Molecular cloning of leukotactin-1: a novel human beta-chemokine, a chemoattractant for neutrophils, monocytes, and lymphocytes, and a potent agonist at CC chemokine receptors 1 and 3.
9346309 1997 Characterisation of macrophage inflammatory protein-5/human CC cytokine-2, a member of the macrophage-inflammatory-protein family of chemokines.
9129202 1997 The chemokine information source: identification and characterization of novel chemokines using the WorldWideWeb and expressed sequence tag databases.
8661057 1996 A YAC contig of the human CC chemokine genes clustered on chromosome 17q11.2.