Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.42

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
psoriasis 6685 1.0e-43
Disease Target Count Z-score Confidence
Moyamoya disease 9 4.111 2.1

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -2.500 1.0e-43

AA Sequence

MPPRGPASELLLLRLLLLGAATAAPLAPRPSKEELTRCLAEVVTEVLTVGQVQRGPCTALLHKELCGTEP      1 - 70
HGCASTEEKGLLLGDFKKQEAGKMRSSQEVRDEEEEEVAERTHKSEVQEQAIRMQGHRQLHQEEDEEEEK     71 - 140
EERKRGPMETFEDLWQRHLENGGDLQKRVAEKASDKETAQFQAEEKGVRVLGGDRSLWQGAERGGGERRE    141 - 210
DLPHHHHHHHQPEAEPRQEKEEASEREEKEVEQLEHLRDELKKVTETLGEQLRREG                  211 - 266
//

Text Mined References (3)

PMID Year Title
15057824 2004 The DNA sequence and biology of human chromosome 19.
12805274 2003 Identification of promoter regions in the human genome by using a retroviral plasmid library-based functional reporter gene assay.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.