Property Summary

NCBI Gene PubMed Count 14
PubMed Score 1.56
PubTator Score 0.26

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (6)

Disease log2 FC p
astrocytic glioma -1.100 5.9e-03
glioblastoma multiforme -1.100 6.5e-18
malignant mesothelioma -1.600 4.8e-06
medulloblastoma, large-cell -1.500 5.2e-03
oligodendroglioma -1.200 5.3e-19
ovarian cancer -1.600 7.9e-09

Gene RIF (3)

AA Sequence

MTSPHFSSYDEGPLDVSMAATNLENQLHSAQKNLLFLQREHASTLKGLHSEIRRLQQHCTDLTYELTVKS      1 - 70
SEQTGDGTSKSSELKKRCEELEAQLKVKENENAELLKELEQKNAMITVLENTIKEREKKYLEELKAKSHK     71 - 140
LTLLSSELEQRASTIAYLTSQLHAAKKKLMSSSGTSDASPSGSPVLASYKPAPPKDKLPETPRRRMKKSL    141 - 210
SAPLHPEFEEVYRFGAESRKLLLREPVDAMPDPTPFLLARESAEVHLIKERPLVIPPIASDRSGEQHSPA    211 - 280
REKPHKAHVGVAHRIHHATPPQAQPEVKTLAVDQVNGGKVVRKHSGTDRTV                       281 - 331
//

Text Mined References (16)

PMID Year Title