Property Summary

NCBI Gene PubMed Count 10
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
Multiple myeloma 1.174 2.7e-03
astrocytic glioma 1.200 1.6e-02
ependymoma 1.500 1.5e-02
oligodendroglioma 1.400 1.1e-02
osteosarcoma 1.266 2.8e-04
primitive neuroectodermal tumor 1.300 1.9e-05
juvenile dermatomyositis 1.028 2.1e-09
intraductal papillary-mucinous adenoma (... 1.200 4.1e-04
group 3 medulloblastoma 1.100 2.2e-03
subependymal giant cell astrocytoma 1.352 3.2e-02
acute myeloid leukemia -1.500 3.9e-02
ovarian cancer -1.600 2.0e-06

Gene RIF (1)

PMID Text
20877624 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MNSRQAWRLFLSQGRGDRWVSRPRGHFSPALRREFFTTTTKEGYDRRPVDITPLEQRKLTFDTHALVQDL      1 - 70
ETHGFDKTQAETIVSALTALSNVSLDTIYKEMVTQAQQEITVQQLMAHLDAIRKDMVILEKSEFANLRAE     71 - 140
NEKMKIELDQVKQQLMHETSRIRADNKLDINLERSRVTDMFTDQEKQLMETTTEFTKKDTQTKSIISETS    141 - 210
NKIDAEIASLKTLMESNKLETIRYLAASVFTCLAIALGFYRFWK                              211 - 254
//

Text Mined References (15)

PMID Year Title
27184846 2016 MCUR1 Is a Scaffold Factor for the MCU Complex Function and Promotes Mitochondrial Bioenergetics.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
16169070 2005 A human protein-protein interaction network: a resource for annotating the proteome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11256614 2000 Systematic subcellular localization of novel proteins identified by large-scale cDNA sequencing.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.