Property Summary

NCBI Gene PubMed Count 9
PubMed Score 0.00

Knowledge Summary


No data available


  Disease (2)

Disease Target Count P-value
psoriasis 6694 3.7e-04
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7


  Differential Expression (1)

Disease log2 FC p
psoriasis 1.300 3.7e-04

 GO Function (1)

 Compartment GO Term (1)

AA Sequence

SPPSGHQPVSDWGEEVELNSPRTTHLAGALSPGEAWPFESV                                 491 - 531

Text Mined References (18)

PMID Year Title