Property Summary

NCBI Gene PubMed Count 14
PubMed Score 59.05
PubTator Score 10.95

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
nephrosclerosis 1.377 1.1e-04
Multiple myeloma 1.523 4.3e-02
malignant mesothelioma -2.800 4.7e-07
astrocytoma -1.900 6.5e-03
ependymoma -1.500 8.5e-03
psoriasis 1.500 2.1e-04
glioblastoma -1.700 2.2e-03
group 4 medulloblastoma -1.900 1.5e-06
atypical teratoid / rhabdoid tumor -1.100 7.5e-05
primitive neuroectodermal tumor -1.900 3.9e-05
tuberculosis 1.100 2.5e-08
intraductal papillary-mucinous adenoma (... -1.400 1.0e-03
intraductal papillary-mucinous carcinoma... -1.500 2.0e-03
intraductal papillary-mucinous neoplasm ... -1.300 9.5e-03
adult high grade glioma -1.400 1.1e-04
subependymal giant cell astrocytoma -1.294 2.8e-02
ovarian cancer 2.400 2.1e-07

Gene RIF (2)

PMID Text
17014843 DIPA can act as a repressor of gene transcription, an activity that appears to be enhanced by p78.
15644333 DIPA is a novel partner of C/EBP beta that down-regulates early events of adipogenesis.

AA Sequence

MEAEAGGLEELTDEEMAALGKEELVRRLRREEAARLAALVQRGRLMQEVNRQLQGHLGEIRELKQLNRRL      1 - 70
QAENRELRDLCCFLDSERQRGRRAARQWQLFGTQASRAVREDLGGCWQKLAELEGRQEELLRENLALKEL     71 - 140
CLALGEEWGPRGGPSGAGGSGAGPAPELALPPCGPRDLGDGSSSTGSVGSPDQLPLACSPDD            141 - 202
//

Text Mined References (16)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24927181 2014 Genome-wide association study identifies three novel susceptibility loci for severe Acne vulgaris.
23128233 2012 Host-microbe interactions have shaped the genetic architecture of inflammatory bowel disease.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
17873903 2008 Coiled-coil domain containing 85B suppresses the beta-catenin activity in a p53-dependent manner.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
17014843 2006 DIPA, which can localize to the centrosome, associates with p78/MCRS1/MSP58 and acts as a repressor of gene transcription.
16713569 2006 A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15644333 2005 Delta-interacting protein A, a new inhibitory partner of CCAAT/enhancer-binding protein beta, implicated in adipocyte differentiation.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9115212 1997 Delta-interacting protein A and the origin of hepatitis delta antigen.
8848724 1996 How did replicating and coding RNAs first get together?
8810253 1996 A cellular homolog of hepatitis delta antigen: implications for viral replication and evolution.