Property Summary

NCBI Gene PubMed Count 14
PubMed Score 10.78
PubTator Score 12.90

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
posterior fossa group B ependymoma 2.100 6.2e-15
atypical teratoid / rhabdoid tumor 1.500 1.1e-03
breast carcinoma -1.500 1.6e-24
group 4 medulloblastoma -1.100 2.4e-03
non-inflammatory breast cancer -2.600 8.7e-06
invasive ductal carcinoma -1.400 8.4e-03
psoriasis -1.300 1.4e-33

Synonym

Accession Q9H0W5 Q8TB26
Symbols 3M3
p90
PPP1R20

Gene

PANTHER Protein Class (1)

PDB

4LG6  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (8)

PMID Text
26423533 HIV-1 Gag is relocalized by CCDC8 from the plasma membrane to the cytoplasm via endocytosis but not via the endolysosome pathway
26423533 HIV-1 infectivity is decreased by overexpression of CCDC8 in producer cells (HEK293T)
24793695 The CUL7, OBSL1, and CCDC8 proteins form a 3M complex that functions in maintaining microtubule and genome integrity and normal development.
24711643 CUL7, OBSL1 and CCDC8 modulate the alternative splicing of the INSR
23018678 Mutations in CUL7, OBSL1 and CCDC8 in 3-M syndrome lead to disordered growth factor signalling.
22156540 discussion of roles of CCDC8, CUL7 (cullin 7), and OBSL1 (obscurin-like 1) in growth and development using findings from patients with Miller-McKusick-Malvaux syndrome and Silver-Russell syndrome [REVIEW]
22084066 p90 is a critical cofactor for p53-mediated apoptosis through promoting Tip60-mediated p53 acetylation.
21737058 We propose that CUL7, OBSL1, and CCDC8 are members of a pathway controlling mammalian growth.

AA Sequence

MLQIGEDVDYLLIPREVRLAGGVWRVISKPATKEAEFRERLTQFLEEEGRTLEDVARIMEKSTPHPPQPP      1 - 70
KKPKEPRVRRRVQQMVTPPPRLVVGTYDSSNASDSEFSDFETSRDKSRQGPRRGKKVRKMPVSYLGSKFL     71 - 140
GSDLESEDDEELVEAFLRRQEKQPSAPPARRRVNLPVPMFEDNLGPQLSKADRWREYVSQVSWGKLKRRV    141 - 210
KGWAPRAGPGVGEARLASTAVESAGVSSAPEGTSPGDRLGNAGDVCVPQASPRRWRPKINWASFRRRRKE    211 - 280
QTAPTGQGADIEADQGGEAADSQREEAIADQREGAAGNQRAGAPADQGAEAADNQREEAADNQRAGAPAE    281 - 350
EGAEAADNQREEAADNQRAEAPADQRSQGTDNHREEAADNQRAEAPADQGSEVTDNQREEAVHDQRERAP    351 - 420
AVQGADNQRAQARAGQRAEAAHNQRAGAPGIQEAEVSAAQGTTGTAPGARARKQVKTVRFQTPGRFSWFC    421 - 490
KRRRAFWHTPRLPTLPKRVPRAGEARNLRVLRAEARAEAEQGEQEDQL                          491 - 538
//

Text Mined References (18)

PMID Year Title
26423533 2015 Inhibition of HIV-1 assembly by coiled-coil domain containing protein 8 in human cells.
25752541 2015 Ankyrin repeats of ANKRA2 recognize a PxLPxL motif on the 3M syndrome protein CCDC8.
24793696 2014 CUL9 mediates the functions of the 3M complex and ubiquitylates survivin to maintain genome integrity.
24793695 2014 The 3M complex maintains microtubule and genome integrity.
24711643 2014 Identifying biological pathways that underlie primordial short stature using network analysis.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23018678 2012 Mutations in CUL7, OBSL1 and CCDC8 in 3-M syndrome lead to disordered growth factor signalling.
22156540 2011 The genetics of 3-M syndrome: unravelling a potential new regulatory growth pathway.
22084066 2011 Differential effects on p53-mediated cell cycle arrest vs. apoptosis by p90.
21737058 2011 Exome sequencing identifies CCDC8 mutations in 3-M syndrome, suggesting that CCDC8 contributes in a pathway with CUL7 and OBSL1 to control human growth.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19389623 2009 Docking motif-guided mapping of the interactome of protein phosphatase-1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11256614 2000 Systematic subcellular localization of novel proteins identified by large-scale cDNA sequencing.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.