Property Summary

NCBI Gene PubMed Count 43
PubMed Score 67.36
PubTator Score 62.59

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
malignant mesothelioma -1.800 5.1e-05
atypical teratoid / rhabdoid tumor 1.500 2.5e-03
glioblastoma 1.200 2.7e-03
acute quadriplegic myopathy 1.260 4.8e-05
primary pancreatic ductal adenocarcinoma 1.045 2.6e-02
tuberculosis and treatment for 6 months 1.200 1.1e-04
intraductal papillary-mucinous neoplasm ... 1.100 4.2e-02
diabetes mellitus -1.100 4.0e-03
Breast cancer 2.100 2.8e-02
group 3 medulloblastoma -1.100 3.1e-02
aldosterone-producing adenoma -1.321 5.8e-03
Polycystic Ovary Syndrome -1.061 3.0e-02
spina bifida -1.637 2.7e-02
ovarian cancer 2.000 7.8e-03

Gene RIF (20)

PMID Text
25885523 we propose that the amount of CCDC6 protein in primary tumors, as reported in lung, may depend on the impairment of the CCDC6 turnover due to altered protein-protein interaction and post-translational modifications
25751255 Results show that RNA-binding protein EWS binds and regulates CCDC6 expression at RNA and protein levels.
25302833 CCDC6 levels provide valuable insight for OS.
24059746 the loss of CCDC6 could aid the spermatogonial cells to be part of a pro-survival pathway that helps to evade the toxic effects of endogenous oxidants and contributes to testicular neoplastic growth.
23578175 Expression of the CCDC6-RET fusion gene in LC-2/ad cells was demonstrated by the mRNA and protein levels, and the genomic break-point was confirmed by genomic DNA sequencing.
23154560 CCDC6-RET fusion is associated with lung adenocarcinoma.
23145146 CCDC6 is associated with cAMP signaling by fine regulating CREB1 transcriptional activity in normal and transformed thyroid cells.
23108047 It was shown that FBXW7 interacts with and targets CCDC6 for ubiquitin-mediated proteasomal degradation. FBXW7-mediated CCDC6 degradation was impaired in response to DNA damage.
22655027 Following genotoxic stress, loss or inactivation of CCDC6 in cancers that carry the CCDC6 fusion, accelerates the dephosphorylation of pH2AX S139, resulting in defective G2 arrest and premature mitotic entry.
22399611 down-regulation of 14-3-3sigma in the absence of CCDC6 demonstrated their direct association and supports the notion that CCDC6 contributes to cancer development, possibly through malignant pathways involving 14-3-3sigma
22363533 CCDC6 plays a key role in cell cycle control.
22327623 we discovered previously unidentified kinase fusions that may be promising for molecular-targeted therapy, kinesin family member 5B (KIF5B)-ret proto-oncogene (RET) and coiled-coil domain containing 6 (CCDC6)-RET, in 14 adenocarcinomas
20498639 repression of CREB1 activity by CCDC6 has a critical function in the development of human thyroid papillary carcinomas carrying RET/PTC1 activation.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19730683 Observational study of gene-disease association. (HuGE Navigator)
19487296 PTC1 and PTC3 are highly oncogenic proteins when overexpressed, but result in indolent disease compared with RET-related MTCs due to their relatively low expression from the NCOA4 and CCDC6 promoters in vivo.
18474871 Observational study of gene-disease association. (HuGE Navigator)
18226854 frequency of the occurrence of BRAF mutation and/or RET/PTC in H4-PTEN positive tumors was extremely high (75%) in papillary thyroid carcinoma
17420723 H4(D10S170) is involved in the cellular response to ataxia telangectasia mutated (ATM) kinase; impairment of H4(D10S170) gene function might have a role in thyroid carcinogenesis.
16385451 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MADSASESDTDGAGGNSSSSAAMQSSCSSTSGGGGGGGGGGGGGKSGGIVISPFRLEELTNRLASLQQEN      1 - 70
KVLKIELETYKLKCKALQEENRDLRKASVTIQARAEQEEEFISNTLFKKIQALQKEKETLAVNYEKEEEF     71 - 140
LTNELSRKLMQLQHEKAELEQHLEQEQEFQVNKLMKKIKKLENDTISKQLTLEQLRREKIDLENTLEQEQ    141 - 210
EALVNRLWKRMDKLEAEKRILQEKLDQPVSAPPSPRDISMEIDSPENMMRHIRFLKNEVERLKKQLRAAQ    211 - 280
LQHSEKMAQYLEEERHMREENLRLQRKLQREMERREALCRQLSESESSLEMDDERYFNEMSAQGLRPRTV    281 - 350
SSPIPYTPSPSSSRPISPGLSYASHTVGFTPPTSLTRAGMSYYNSPGLHVQHMGTSHGITRPSPRRSNSP    351 - 420
DKFKRPTPPPSPNTQTPVQPPPPPPPPPMQPTVPSAATSQPTPSQHSAHPSSQP                    421 - 474
//

Text Mined References (56)

PMID Year Title
25885523 2015 FBXW7 and USP7 regulate CCDC6 turnover during the cell cycle and affect cancer drugs susceptibility in NSCLC.
25751255 2015 The cell cycle regulator CCDC6 is a key target of RNA-binding protein EWS.
25302833 2015 New therapeutic perspectives in CCDC6 deficient lung cancer cells.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24059746 2013 Critical role of CCDC6 in the neoplastic growth of testicular germ cell tumors.
23578175 2013 Identification of a lung adenocarcinoma cell line with CCDC6-RET fusion gene and the effect of RET inhibitors in vitro and in vivo.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23154560 2012 Identification of CCDC6-RET fusion in the human lung adenocarcinoma cell line, LC-2/ad.
23145146 2012 Identification of sumoylation sites in CCDC6, the first identified RET partner gene in papillary thyroid carcinoma, uncovers a mode of regulating CCDC6 function on CREB1 transcriptional activity.
23108047 2012 FBXW7-mediated degradation of CCDC6 is impaired by ATM during DNA damage response in lung cancer cells.
22655027 2012 Loss of CCDC6, the first identified RET partner gene, affects pH2AX S139 levels and accelerates mitotic entry upon DNA damage.
22399611 2012 Silencing of CCDC6 reduces the expression of 14-3-3? in colorectal carcinoma cells.
22363533 2012 Loss of CCDC6 affects cell cycle through impaired intra-S-phase checkpoint control.
22327623 2012 RET, ROS1 and ALK fusions in lung cancer.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20498639 2010 CCDC6 represses CREB1 activity by recruiting histone deacetylase 1 and protein phosphatase 1.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19730683 2009 The variant rs1867277 in FOXE1 gene confers thyroid cancer susceptibility through the recruitment of USF1/USF2 transcription factors.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19487296 2009 Transcript level modulates the inherent oncogenicity of RET/PTC oncoproteins.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19156129 2009 An integrated workflow for charting the human interaction proteome: insights into the PP2A system.
18715871 2008 PP4R4/KIAA1622 forms a novel stable cytosolic complex with phosphoprotein phosphatase 4.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18474871 2008 Common SNP in pre-miR-146a decreases mature miR expression and predisposes to papillary thyroid carcinoma.
18226854 2008 Incidentally simultaneous occurrence of RET/PTC, H4-PTEN and BRAF mutation in papillary thyroid carcinoma.
18220336 2008 Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis.
18088087 2008 Phosphoproteome of resting human platelets.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17924679 2007 Improved titanium dioxide enrichment of phosphopeptides from HeLa cells and high confident phosphopeptide identification by cross-validation of MS/MS and MS/MS/MS spectra.
17420723 2007 Involvement of H4(D10S170) protein in ATM-dependent response to DNA damage.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16964243 2006 A probability-based approach for high-throughput protein phosphorylation analysis and site localization.
16385451 2006 A scan of chromosome 10 identifies a novel locus showing strong association with late-onset Alzheimer disease.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
15144186 2004 Robust phosphoproteomic profiling of tyrosine phosphorylation sites from human T cells using immobilized metal affinity chromatography and tandem mass spectrometry.
14712216 2004 H4(D10S170), a gene frequently rearranged with RET in papillary thyroid carcinomas: functional characterization.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8889549 1996 Generation and analysis of 280,000 human expressed sequence tags.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8058316 1994 Cloning and characterization of H4 (D10S170), a gene involved in RET rearrangements in vivo.
7753554 1995 Characterization of the promoter region and oligomerization domain of H4 (D10S170), a gene frequently rearranged with the ret proto-oncogene.
6745938 1984 Estimating the recombination frequency for the PTC-Kell linkage.
3600795 1987 A new oncogene in human thyroid papillary carcinomas and their lymph-nodal metastases.
2902563 1988 RFLP for TaqI of the human thyroid papillary carcinoma (PTC) oncogene.
2406025 1990 PTC is a novel rearranged form of the ret proto-oncogene and is frequently detected in vivo in human thyroid papillary carcinomas.
2334411 1990 cDNA cloning and characterization of ret activated in a human papillary thyroid carcinoma cell line.
1678508 1991 An STS in the human PTC oncogene located at 10q11.2.
775355 1976 [The dynamics of cerebrospinal fluid circulation (author's transl)].