Property Summary

NCBI Gene PubMed Count 19
PubMed Score 8.96
PubTator Score 7.67

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (23)

Disease log2 FC p
Rheumatoid Arthritis 1.700 9.0e-03
oligodendroglioma 1.400 1.7e-12
astrocytoma 1.200 8.7e-14
glioblastoma 2.000 8.2e-10
osteosarcoma 1.372 1.6e-02
ependymoma 1.400 6.4e-09
sonic hedgehog group medulloblastoma 2.400 1.4e-09
atypical teratoid / rhabdoid tumor 1.500 1.7e-04
medulloblastoma, large-cell 1.600 7.1e-04
primitive neuroectodermal tumor 2.300 3.2e-05
adrenocortical carcinoma -1.051 1.6e-02
primary pancreatic ductal adenocarcinoma 1.214 2.6e-03
tuberculosis and treatment for 6 months 1.400 3.3e-06
non-small cell lung cancer -1.907 1.6e-21
pediatric high grade glioma 2.000 5.6e-09
pilocytic astrocytoma 2.900 6.2e-13
aldosterone-producing adenoma -1.272 1.3e-02
breast carcinoma -1.600 1.7e-34
Breast cancer -1.900 3.3e-29
ductal carcinoma in situ -1.700 1.3e-04
invasive ductal carcinoma -2.100 1.6e-04
ovarian cancer -1.800 1.0e-09
head and neck cancer -1.100 3.0e-02

Gene RIF (5)

PMID Text
22331027 Ymer acts as a regulator downstream of several receptors and that Ymer functions as a positive or negative regulator in a signaling pathway-dependent manner.
19641524 CCDC50 is required for survival in mantle cell lymphoma and chronic lymphocytic leukemia cells and controls NFkappaB signaling
19059208 These findings demonstrate that Ymer is likely to be a negative regulator for the NF-kappaB signaling pathway.
16803894 Ymer functions as a novel inhibitor for the down-regulation of the EGF receptor and plays a crucial role for regulating the amount of the EGF receptor on the cell surface membrane
12483295 identification of a novel DFNA locus on chromosome 3q28-29 in a Spanish family with postlingual and progressive hearing loss[DFNA44]

AA Sequence

MAEVSIDQSKLPGVKEVCRDFAVLEDHTLAHSLQEQEIEHHLASNVQRNRLVQHDLQVAKQLQEEDLKAQ      1 - 70
AQLQKRYKDLEQQDCEIAQEIQEKLAIEAERRRIQEKKDEDIARLLQEKELQEEKKRKKHFPEFPATRAY     71 - 140
ADSYYYEDGGMKPRVMKEAVSTPSRMAHRDQEWYDAEIARKLQEEELLATQVDMRAAQVAQDEEIARLLM    141 - 210
AEEKKAYKKAKEREKSSLDKRKQDPEWKPKTAKAANSKSKESDEPHHSKNERPARPPPPIMTDGEDADYT    211 - 280
HFTNQQSSTRHFSKSESSHKGFHYKH                                                281 - 306
//

Text Mined References (22)

PMID Year Title
23562540 2013 GWAS of cerebrospinal fluid tau levels identifies risk variants for Alzheimer's disease.
23418353 2013 The E3 ubiquitin ligases RNF126 and Rabring7 regulate endosomal sorting of the epidermal growth factor receptor.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22331027 2012 Ymer acts as a multifunctional regulator in nuclear factor-?B and Fas signaling pathways.
21269460 2011 Initial characterization of the human central proteome.
19641524 2009 Gene knockdown studies revealed CCDC50 as a candidate gene in mantle cell lymphoma and chronic lymphocytic leukemia.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19059208 2009 Inhibition of NF-kappaB signaling via tyrosine phosphorylation of Ymer.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
18029035 2008 Involvement of Ymer in suppression of NF-kappaB activation by regulated interaction with lysine-63-linked polyubiquitin chain.
17503326 2007 A mutation in CCDC50, a gene encoding an effector of epidermal growth factor-mediated cell signaling, causes progressive hearing loss.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16803894 2006 Suppression of the ligand-mediated down-regulation of epidermal growth factor receptor by Ymer, a novel tyrosine-phosphorylated and ubiquitinated protein.
15951569 2005 Time-resolved mass spectrometry of tyrosine phosphorylation sites in the epidermal growth factor receptor signaling network reveals dynamic modules.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15314609 2004 Temporal analysis of phosphotyrosine-dependent signaling networks by quantitative proteomics.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14527723 2003 Identification and characterization of C3orf6, a new conserved human gene mapping to chromosome 3q28.
12483295 2003 A novel locus for autosomal dominant nonsyndromic hearing loss (DFNA44) maps to chromosome 3q28-29.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.