Property Summary

NCBI Gene PubMed Count 6
PubMed Score 1.40

Knowledge Summary


No data available


  Disease (1)

Disease Target Count Z-score Confidence
Heroin dependence 30 4.741 2.4
Azoospermia 89 3.238 1.6


AA Sequence

ALEDTHKQLDMIQQFIQDRSDIWAEVKKKEQQRVRI                                      281 - 316

Text Mined References (6)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489335 2004 Human ORFeome version 1.1: a platform for reverse proteomics.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.