Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
lung adenocarcinoma 2716 4.0e-08
invasive ductal carcinoma 2951 7.3e-04
fibroadenoma 559 1.0e-02

Expression

  Differential Expression (3)

Disease log2 FC p
fibroadenoma 1.300 1.0e-02
invasive ductal carcinoma 1.100 7.3e-04
lung adenocarcinoma 1.400 4.0e-08

AA Sequence

MLRHSPSLWELVEEHVPLRERREVKRILGEAAVDLSLELRAEVAMLRALLQEARSSQAPSSRPISDPSSL      1 - 70
LAPPPLLKDLLRQELRQLLQGLRHKAICEGRDQAQAWVQYSPRVLHFALEEPRCDLPEQEIFQMRGGGPS     71 - 140
SGHRDLSIIKDQLNVSNIDQVARHLRGLLEEECHTLEREILILQRCLEEEYLRPCHPSEAALEPTLAELK    141 - 210
EQKKAMEQELQASVGPSCVSPNHRQRPLGSSTQGLRPPLPLCGVAPLQCCLPAPPLEPYLRPRGQSATHR    211 - 280
WGRQLQCSPREGPASTPMSSAAPQAPA                                               281 - 307
//

Text Mined References (6)

PMID Year Title