Property Summary

NCBI Gene PubMed Count 8
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (6)

Disease log2 FC p
adult high grade glioma -1.600 1.0e-05
atypical teratoid / rhabdoid tumor -1.200 1.2e-02
ependymoma -1.600 9.5e-12
glioblastoma -1.300 8.5e-06
group 3 medulloblastoma -2.500 2.6e-05
medulloblastoma, large-cell -2.400 3.1e-06

Gene RIF (1)

AA Sequence

MEDGLLEIMTKDGGDMPAPLEVSTVPAVGDVISGEYNGGMKELMEHLKAQLQALFEDVRAMRGALDEQAS      1 - 70
HIQVLSDDVCANQRAIVSMCQIMTTAPRQGGLGVVGGKGSFQSDPQEPETPSPGIGDSGLLGRDPEDEEE     71 - 140
EEEEKEMPSPATPSSHCERPESPCAGLLGGDGPLVEPLDMPDITLLQLEGEASL                    141 - 194
//

Text Mined References (10)

PMID Year Title