Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.38

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
psoriasis 6694 1.3e-05
medulloblastoma, large-cell 6241 1.4e-04
group 3 medulloblastoma 4104 2.3e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7

Gene RIF (1)

AA Sequence

MSLESLFQHIIFTEHQAEESRRLMREVRSEITRCREKIKKATEELNEEKIKLESKVQQFFEKSFFLQLLK      1 - 70
AHENALEKQYSEITNHRNMLLQTFEAIKKQMIEEEDKFIKEITDFNNDYEITKKRELLMKENVKIEISDL     71 - 140
ENQANMLKSEMKSMEHDSSQLNELQKQKSELIQELFTLQRKLKVFEDEENESICTTKYLEAEKIKISEKP    141 - 210
QNDTECLRLKKELELYKEDDMESVYEALQTEIEFLELTLAQKDLQESK                          211 - 258
//

Text Mined References (7)

PMID Year Title