Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
osteosarcoma 7950 2.1e-08
nasopharyngeal carcinoma 1058 2.6e-07
chronic rhinosinusitis 512 2.1e-02
Disease Target Count Z-score Confidence
Keratoacanthoma 1 4.447 2.2

Expression

  Differential Expression (3)

Disease log2 FC p
chronic rhinosinusitis -1.621 2.1e-02
nasopharyngeal carcinoma -1.700 2.6e-07
osteosarcoma -2.679 2.1e-08

 Compartment GO Term (1)

AA Sequence

MDSHSGEPALLPCGTCDMVFRSSALLATHTQRFCIGHPTQEMTFGAQASVATEPQRAAVVPQEHQGVPQE      1 - 70
PQGLPDQQASRSALKRLTEEVQWLRLSLQEMRPWITEVPRVFAGPWTRSEARPQSPMSEAVGSPSERLRA     71 - 140
LFRTRARRVAEMEAQSRALQLRGEELSRRLQVVACTRGGMSRLFGLEQEIRELQAEAGRTRGALEVLGAR    141 - 210
IQELQAEPGNPLSSRREAELYSPVQKANPGTLAAEIRALREAYIRDGGRDPGVLGQIWQLQVEASALELQ    211 - 280
RSQTRRGRAGATSGELPVVEAENRRLEAEILALQMQRGRAPLGPQDLRLLGDASLQPKGRRDPPLLPPPV    281 - 350
APPLPPLPGFSEPQLPGTMTRNLGLDSHFLLPTSDMLGPAPYDPGAGLVIFYDFLRGLEASWIWVQLRTG    351 - 420
LARDGRDTGRTTALPPALCLPPPPAPGPMGNCAILASRQPVPRLPPSSSVSLVCELQVWQGLAWARAPQP    421 - 490
KAWVSLGLFDQDQRVLSGRWRLPLRALPLDPSLSLGQLNGIPQAGQAELFLRLVNARDAAVQTLAEINPA    491 - 560
SVHEYQYPPPVSSTSSLEASFLTPAVGFADPPPRTEEPLSGVKDRDEGLGPHHSSDLPPVSF            561 - 622
//

Text Mined References (6)

PMID Year Title