Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (3)

Disease log2 FC p
adrenocortical carcinoma -1.011 9.3e-06
osteosarcoma -1.336 4.0e-04
subependymal giant cell astrocytoma 1.324 1.9e-02

AA Sequence

MLLPASDPLLAGLPRDPDYSVSCLYSPPSPSSMCLPANMKCDKYWGSSSDKALERTAHWSRTPEPETLGC      1 - 70
PASGDTVRTADCRPGWGSGPSPHEAAPSPSPDLQKQCCNDQDILKRHHNVAKKPLETSSSKVKAKTIVMI     71 - 140
PDSQKLLRCELESLKSQLQAQTKAFEFLNHSVTMLEKESCLQQIKIQQLEEVLSPTGRQGEKEEHKWGME    141 - 210
QGRQELYGALTQGLQGLEKTLRDSEEMQRARTTRCLQLLAQEIRDSKKFLWEELELVREEVTFIYQKLQA    211 - 280
QEDEISENLVNIQKMQKTQVKCRKILTKMKQQGHETAACPETEEIPQGASGCWKDDLQKELSDIWSAVHV    281 - 350
LQNSIDSLTLCSGACPKASSLRGHKGHQCLSPPLPSWDSDSDCDQDLSQPPFSKSGRSFPPA            351 - 412
//

Text Mined References (6)

PMID Year Title