Property Summary

NCBI Gene PubMed Count 10
PubMed Score 2.19
PubTator Score 2.78

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Ciliary Dyskinesia, Primary, 30 1 0.0 0.0
Disease Target Count P-value
psoriasis 6694 2.0e-17
ependymoma 4679 1.9e-07
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6

Expression

  Differential Expression (2)

Disease log2 FC p
ependymoma 1.600 1.9e-07
psoriasis -1.100 2.0e-17

Gene RIF (2)

AA Sequence

MTSPLCRAASANALPPQDQASTPSSRVKGREASGKPSHLRGKGTAQAWTPGRSKGGSFHRGAGKPSVHSQ      1 - 70
VAELHKKIQLLEGDRKAFFESSQWNIKKNQETISQLRKETKALELKLLDLLKGDEKVVQAVIREWKWEKP     71 - 140
YLKNRTGQALEHLDHRLREKVKQQNALRHQVVLRQRRLEELQLQHSLRLLEMAEAQNRHTEVAKTMRNLE    141 - 210
NRLEKAQMKAQEAEHITSVYLQLKAYLMDESLNLENRLDSMEAEVVRTKHELEALHVVNQEALNARDIAK    211 - 280
NQLQYLEETLVRERKKRERYISECKKRAEEKKLENERMERKTHREHLLLQSDDTIQDSLHAKEEELRQRW    281 - 350
SMYQMEVIFGKVKDATGTDETHSLVRRFLAQGDTFAQLETLKSENEQTLVRLKQEKQQLQRELEDLKYSG    351 - 420
EATLVSQQKLQAEAQERLKKEERRHAEAKDQLERALRAMQVAKDSLEHLASKLIHITVEDGRFAGKELDP    421 - 490
QADNYVPNLLGLVEEKLLKLQAQLQGHDVQEMLCHIANREFLASLEGRLPEYNTRIALPLATSKDKFFDE    491 - 560
ESEEEDNEVVTRASLKIRSQKLIESHKKHRRSRRS                                       561 - 595
//

Text Mined References (11)

PMID Year Title