Property Summary

NCBI Gene PubMed Count 8
PubMed Score 0.16

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
astrocytic glioma -1.600 1.3e-02
atypical teratoid / rhabdoid tumor -1.400 4.3e-09
ependymoma -1.800 1.9e-02
glioblastoma -1.100 4.9e-05
group 4 medulloblastoma -1.300 3.9e-03
intraductal papillary-mucinous adenoma (... 1.100 7.0e-04
medulloblastoma, large-cell -1.600 9.1e-06
oligodendroglioma -1.500 2.4e-02
pediatric high grade glioma -1.300 4.1e-04
primary Sjogren syndrome -1.100 1.9e-02
primitive neuroectodermal tumor -1.100 1.1e-02
tuberculosis 1.200 3.2e-05

Gene RIF (2)

AA Sequence

MANQLRERHQSLKKKYRELIDGDPSLPPEKRKQANLAQLLRDSQDRNKHLGEEIKELQQRLGEVQGDNKL      1 - 70
LRMTIAKQRLGDEAIGVRHFAAHEREDLVQQLERAKEQIESLEHDLQASVDELQDVKEERSSYQDKVERL     71 - 140
NQELNHILSGHENRIIDVDALCMENRYLQERLKQLHEEVNLLKSNIAKYKNALERRKNSKGQGKSSSSAL    141 - 210
TGVLSAKQVQDLLSEDHGCSLPATPQSISDLKSLATALLETIHEKNMVIQHQRQTNKILGNRVAELEKKL    211 - 280
RTLEVSGLWSLPGGKDTILFSDPTLPSGQRSRSPLLKFVEQPTENKADPKDGEAQKQEEDESCAAAEALT    281 - 350
APEDAGRPAVNSPANQSRGNQCKLFHPSLPQLPSEEEVNSLGREIIKLTKEQAAAELEEVRRESPIEGQR    351 - 420
SETGPAPPGLAIQGELPKSHLDSFEASRPAAKASTPEDGKGIPEGGGMRSTVKT                    421 - 474
//

Text Mined References (11)

PMID Year Title