Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.08
PubTator Score 0.13

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
psoriasis 6694 1.0e-08
ovarian cancer 8520 6.3e-07

AA Sequence

MGDECSNPDLLAEPGSSPPWDHGNQRQEAANESNTRVPRVLKAHLGPETAQPTKRSKRNRWRRQSCQGPS      1 - 70
PARSGQFLGSADLGLQRGVLKSAARTCLSEISNSTRASPESAQSTDPGRAARPRTRTLPTPHSFKIGEEA     71 - 140
EEMKKKKERKRRKERKKERNFKK                                                   141 - 163
//

Text Mined References (7)

PMID Year Title