Property Summary

NCBI Gene PubMed Count 12
PubMed Score 5.89
PubTator Score 2.58

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (9)

Disease log2 FC p
adult high grade glioma -1.600 7.2e-05
Astrocytoma, Pilocytic -2.000 1.6e-08
atypical teratoid / rhabdoid tumor -3.000 4.8e-07
ependymoma -1.300 7.8e-07
glioblastoma -2.000 1.3e-06
group 3 medulloblastoma -2.200 6.8e-05
medulloblastoma, large-cell -2.500 9.0e-06
osteosarcoma -1.070 1.3e-02
subependymal giant cell astrocytoma -3.370 3.4e-03

Gene RIF (4)

AA Sequence

MQAMEGEVLLPALYEEEEEEEEEEEEVEEEEEQVQKGGSVGSLSVNKHRGLSLTETELEELRAQVLQLVA      1 - 70
ELEETRELAGQHEDDSLELQGLLEDERLASAQQAEVFTKQIQQLQGELRSLREEISLLEHEKESELKEIE     71 - 140
QELHLAQAEIQSLRQAAEDSATEHESDIASLQEDLCRMQNELEDMERIRGDYEMEIASLRAEMEMKSSEP    141 - 210
SGSLGLSDYSGLQEELQELRERYHFLNEEYRALQESNSSLTGQLADLESERTQRATERWLQSQTLSMTSA    211 - 280
ESQTSEMDFLEPDPEMQLLRQQLRDAEEQMHGMKNKCQELCCELEELQHHRQVSEEEQRRLQRELKCAQN    281 - 350
EVLRFQTSHSVTQNEELKSRLCTLQKKYDTSQDEQNELLKMQLQLQTELRQLKVMKSTLVENQSEKELLC    351 - 420
RLQKLHLQHQNVTCEKEKLLERQQQLQEELQCHEAELQHLRDTVASFKESNEKDTETHAQLQEMKQLYQA    421 - 490
SKDELERQKHMYDQLEQDLLLCQLELKELKASHPIPEDKGKCANKCDTLLSRLTELQEKYKASQKEMGQL    491 - 560
QMEQCELLEDQRRMQEEQGQLQEELHRLTLPLPKSGLLLKSQELLTKLEDLCELQLLYQGMQEEQKKLIQ    561 - 630
NQDCVLKEQLEIHEELRRFKESHFQEVLENPDDSKLAKSSKCNRNKQSKLLMEQMQALQVMYDAGQAKQE    631 - 700
LLQQEQGRLLEERKRLQADLQLCLEEMQLLQVQSPSIKMSLESYGKSYGSMVPSNENCRKTYDTTVDDNE    701 - 770
SYYKSYTSTQTSSKSFLKSYDSSTSASEAYGKSYCTTSNSSITYKKSYGSTSSSDTCQKSFVSSCTDEEP    771 - 840
AEPEDMERFEEMVVKVLIKLQAVQAMYQISQEEHSQLQEQMEKLLAKQKDLKEELDACEREFKECMECLE    841 - 910
KPMAPQNDKNEIKELQTKLRELQLQYQASMDEQGRLLVVQEQLEGQLQCCQEELRQLREKRPSVVKEARG    911 - 980
KNANKNMNKNANGVKMKKVTKPCSDTSESDLETRKSLEVVLYYKASQRKLDGLAKEEEKKEEMEEEKKQV    981 - 1050
KEEAKEQCGDELVAEPADPEEAKSTEDQEENEEDKEEEEKEEDSEEEEDDADSSLESPEENNPLRLSESK   1051 - 1120
KSSPTPNPPIFSLPLVGLVVISALLWCWWAETSS                                       1121 - 1154
//

Text Mined References (16)

PMID Year Title