Property Summary

NCBI Gene PubMed Count 12
PubMed Score 3.96
PubTator Score 4.49

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Liver neoplasms 130 0.0 0.0
Precancerous Conditions 80 0.0 0.0
Disease Target Count Z-score Confidence
Alzheimer's disease 658 0.0 1.7

Expression

Gene RIF (5)

AA Sequence

MDLLQFLAFLFVLLLSGMGATGTLRTSLDPSLEIYKKMFEVKRREQLLALKNLAQLNDIHQQYKILDVML      1 - 70
KGLFKVLEDSRTVLTAADVLPDGPFPQDEKLKDAFSHVVENTAFFGDVVLRFPRIVHYYFDHNSNWNLLI     71 - 140
RWGISFCNQTGVFNQGPHSPILSLMAQELGISEKDSNFQNPFKIDRTEFIPSTDPFQKALREEEKRRKKE    141 - 210
EKRKEIRKGPRISRSQSEL                                                       211 - 229
//

Text Mined References (14)

PMID Year Title