Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.07
PubTator Score 0.20

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
astrocytic glioma -1.200 3.9e-02
osteosarcoma -1.821 3.1e-04
ependymoma -1.100 4.2e-04
atypical teratoid / rhabdoid tumor -1.300 2.1e-03
glioblastoma -1.500 2.7e-03
medulloblastoma -1.300 4.0e-03
medulloblastoma, large-cell -2.600 2.2e-04
adult high grade glioma -1.400 1.7e-03
subependymal giant cell astrocytoma -1.660 1.1e-02
ductal carcinoma in situ -1.100 9.8e-04
invasive ductal carcinoma -1.300 5.9e-03
ovarian cancer -1.800 1.5e-06

Synonym

Accession Q96BQ5
Symbols

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Pathway (1)

AA Sequence

MNNLNDPPNWNIRPNSRADGGDGSRWNYALLVPMLGLAAFRWIWSRESQKEVEKEREAYRRRTAAFQQDL      1 - 70
EAKYHAMISENRRAVAQLSLELEKEQNRTASYREALISQGRKLVEEKKLLEQERAQVMQEKRQVQPLRSA     71 - 140
YLSCLQREENWQRRARLLLKEFEAVLTERQNIYCSLFLPRSKRLEIEKSLLVRASVDPVAADLEMAAGLT    141 - 210
DIFQHDTYCGDVWNTNKRQNGRLMWLYLKYWELVVELKKFKRVEEAILEK                        211 - 260
//

Text Mined References (6)

PMID Year Title
21269460 2011 Initial characterization of the human central proteome.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15231748 2004 Functional proteomics mapping of a human signaling pathway.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.