Property Summary

NCBI Gene PubMed Count 11
PubMed Score 1.20
PubTator Score 1.20

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Leprosy 73 5.044 2.5
Polydactyly 107 3.089 1.5

Expression

Gene RIF (3)

AA Sequence

MSDNKERKSQGFPKEDNQDTSSLADAVEKVAKQQQSQASEIEKNKKVLFNLKNELHELEKEIAAISAETK      1 - 70
ETERQIYQQDSAIENTKLHCDSLETQIKSLHSENVKLKFDIETAQEDFEEHMIKYNAYYAKIKAHKNSLG     71 - 140
EVESKWSFMTELHEKRDFVKKLKTMKEELMQDLQNPGGNRITQVQEDITNLKDKIITVKESIIEKTCFLE    141 - 210
EEKKTHEKLRKEIEVQHKRYDAILKRLHCQVNKLQSNRRQWQWNIQQLEKTAAELRKCIGMQE           211 - 273
//

Text Mined References (13)

PMID Year Title