Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.10
PubTator Score 0.63

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
ependymoma 4559 1.5e-08
Astrocytoma, Pilocytic 3006 1.3e-06
atypical teratoid / rhabdoid tumor 4971 3.3e-05
Disease Target Count Z-score Confidence
Carcinoma 11192 0.0 0.5
Disease Target Count Z-score Confidence
Diabetic cataract 6 4.427 2.2

Expression

  Differential Expression (3)

Disease log2 FC p
Astrocytoma, Pilocytic 1.400 1.3e-06
atypical teratoid / rhabdoid tumor 1.600 3.3e-05
ependymoma 1.400 1.5e-08

Synonym

Accession Q96A19 Q9BT74
Symbols

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 GO Function (1)

 GO Component (1)

AA Sequence

MSHGPSPRLAESPQLSKGSLLTILGSPSPERMGPADSLPPTPPSGTPSPGPPPALPLPPAPALLADGDWE      1 - 70
SREELRLRELEEARARAAQMEKTMRRWSDCTANWREKWSKVRAERNRAREEVRQLRQRLDALTKELAGAR     71 - 140
RERQEAQGECEARGRELARLRGARGVADQTRDGPEPEAEREPVRDVGSERPPGSQELELVESLLKSMPEE    141 - 210
SEDCWEARSLGAGGPRGSSGRQERSRLPWEDTAATEEEASKLTALRLRLDESQKVLLKEREDKLALSRNI    211 - 280
EKLEGELSQWKIKYEELSKTKQEMLKQLSILKEAHQDELGRMSEDLEDELGARSSMDRKMAELRGEMERL    281 - 350
QAENAAEWGRRERLETEKLGLERENKKLRAQVGDLEEALARRRRQTASALDCDLRASQAALFEKNKELAD    351 - 420
LKHVHGKLKKQFQEKVAELAHANRRVEQHEAEVKKLRLRVEELKKELAQAEDELDEAHNQARKLQRSLDE    421 - 490
QTEQSENLQVQLEHLQSRLRRQQQNAPLFGKIRSARFGTEEAEDGTSDLDEDEDLQIQVA              491 - 550
//

Text Mined References (8)

PMID Year Title