Property Summary

NCBI Gene PubMed Count 40
PubMed Score 197.71
PubTator Score 16.35

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (3)

Disease log2 FC p
ovarian cancer 1.200 4.9e-03
posterior fossa group B ependymoma 1.300 1.7e-09
tuberculosis and treatment for 6 months -1.200 1.7e-05

Protein-protein Interaction (3)

Gene RIF (27)

AA Sequence

MPFFGNTFSPKKTPPRKSASLSNLHSLDRSTREVELGLEYGSPTMNLAGQSLKFENGQWIAETGVSGGVD      1 - 70
RREVQRLRRRNQQLEEENNLLRLKVDILLDMLSESTAESHLMEKELDELRISRKRK                   71 - 126
//

Text Mined References (43)

PMID Year Title