Property Summary

NCBI Gene PubMed Count 25
PubMed Score 171.60
PubTator Score 1111.57

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
lung cancer 4473 1.7e-03
Disease Target Count Z-score Confidence
Conversion disorder 7 3.448 1.7

Expression

  Differential Expression (1)

Disease log2 FC p
lung cancer 1.500 1.7e-03

 MGI Phenotype (1)

Gene RIF (9)

PMID Text
26837964 The difference in the SUZ12 and CBX8 genes expression were significantly divergent between tumors and their marginal tissues.
26718407 These data suggest that CBX8 modulates SIPS through the RB-E2F1 pathway in CML cells and provide important insight into its application in CML treatment.
25360999 Low CBX8 expression was associated with distant metastasis in colorectal cancer.
25197352 CBX8 might emerge as an oncogene for promoting the proliferation of tumor cells and raising the resistance of neoplasms to chemotherapy.
24460908 The presence of CBX8-GFP in the same focus had a minor impact on BMI1 and RING1 recovery kinetics.
23891621 Interaction with CBX8 precludes AF9-DOT1L binding.
23474493 CBX8 cooperated with SIRT1 for suppressing p53 acetylation induced by Sirtinol and etoposide/TSA. Upon ectopic expression, CBX8 or SIRT1 repressed the expression of p21(WAF1) by inhibiting p53 binding to the promoter.
22094252 CBX8 plays an essential role in MLL-AF9 transcriptional regulation and leukemogenesis.
17332741 CBX8 is an essential component of one of the polycomb repressive complexes, which directly regulate the expression of numerous target genes, including the INK4A-ARF locus, involved in cell-fate decisions.

AA Sequence

MELSAVGERVFAAEALLKRRIRKGRMEYLVKWKGWSQKYSTWEPEENILDARLLAAFEEREREMELYGPK      1 - 70
KRGPKPKTFLLKAQAKAKAKTYEFRSDSARGIRIPYPGRSPQDLASTSRAREGLRNMGLSPPASSTSTSS     71 - 140
TCRAEAPRDRDRDRDRDRERDRERERERERERERERERERGTSRVDDKPSSPGDSSKKRGPKPRKELPDP    141 - 210
SQRPLGEPSAGLGEYLKGRKLDDTPSGAGKFPAGHSVIQLARRQDSDLVQCGVTSPSSAEATGKLAVDTF    211 - 280
PARVIKHRAAFLEAKGQGALDPNGTRVRHGSGPPSSGGGLYRDMGAQGGRPSLIARIPVARILGDPEEES    281 - 350
WSPSLTNLEKVVVTDVTSNFLTVTIKESNTDQGFFKEKR                                   351 - 389
//

Text Mined References (33)

PMID Year Title
26837964 Evaluating of suppressor of zeste 12 and chromobox homolog 8 genes expression showed two possible origins for gastric cancer development.
26718407 2016 CBX8 antagonizes the effect of Sirtinol on premature senescence through the AKT-RB-E2F1 pathway in K562 leukemia cells.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
25416956 2014 A proteome-scale map of the human interactome network.
25360999 2014 Paradoxical role of CBX8 in proliferation and metastasis of colorectal cancer.
25197352 2014 CBX8, a novel DNA repair protein, promotes tumorigenesis in human esophageal carcinoma.
24460908 2014 PRC1 components exhibit different binding kinetics in Polycomb bodies.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23891621 2013 CBX8, a component of the Polycomb PRC1 complex, modulates DOT1L-mediated gene expression through AF9/MLLT3.
23474493 2013 CBX8 suppresses Sirtinol-induced premature senescence in human breast cancer cells via cooperation with SIRT1.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22094252 2011 CBX8, a polycomb group protein, is essential for MLL-AF9-induced leukemogenesis.
21282530 2011 Interaction proteomics analysis of polycomb proteins defines distinct PRC1 complexes in mammalian cells.
21269460 2011 Initial characterization of the human central proteome.
21047797 2011 Recognition and specificity determinants of the human cbx chromodomains.
21029866 2010 Nucleosome-interacting proteins regulated by DNA and histone methylation.
20601937 2010 Ubiquitin-specific proteases 7 and 11 modulate Polycomb regulation of the INK4a tumour suppressor.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19636380 2009 Several distinct polycomb complexes regulate and co-localize on the INK4a tumor suppressor locus.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17332741 2007 Bypass of senescence by the polycomb group protein CBX8 through direct binding to the INK4A-ARF locus.
16169070 2005 A human protein-protein interaction network: a resource for annotating the proteome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15009096 2004 Proteomics analysis of the centromere complex from HeLa interphase cells: UV-damaged DNA binding protein 1 (DDB-1) is a component of the CEN-complex, while BMI-1 is transiently co-localized with the centromeric region in interphase.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12167701 2002 The core of the polycomb repressive complex is compositionally and functionally conserved in flies and humans.
11439343 2001 The polycomb protein MPc3 interacts with AF9, an MLL fusion partner in t(9;11)(p22;q23) acute leukemias.
11313972 2001 The ENL moiety of the childhood leukemia-associated MLL-ENL oncoprotein recruits human Polycomb 3.
10825164 2000 HPC3 is a new human polycomb orthologue that interacts and associates with RING1 and Bmi1 and has transcriptional repression properties.