Property Summary

NCBI Gene PubMed Count 125
PubMed Score 80.61
PubTator Score 390.76

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
Rheumatoid Arthritis 1.300 1.1e-02
astrocytic glioma 1.100 4.9e-02
ependymoma 1.800 4.9e-07
oligodendroglioma 1.800 9.9e-03
permanent atrial fibrillation -1.200 1.5e-02
osteosarcoma 2.065 3.1e-04
atypical teratoid / rhabdoid tumor 2.200 4.8e-06
glioblastoma 1.500 3.3e-04
group 3 medulloblastoma 1.400 8.3e-04
medulloblastoma, large-cell 2.000 6.5e-06
primitive neuroectodermal tumor 1.700 4.1e-04
adrenocortical carcinoma 1.378 5.4e-04
sarcoidosis 1.200 1.9e-02
cystic fibrosis -1.100 4.9e-03
pediatric high grade glioma 1.200 1.4e-03
acute myeloid leukemia 1.400 1.5e-02
lung adenocarcinoma 1.100 1.3e-06
lung carcinoma 1.100 6.3e-21
Alzheimer's disease 1.100 4.3e-02
Pick disease 1.600 3.5e-05
ovarian cancer 2.000 9.5e-06

Protein-protein Interaction (3)

Gene RIF (72)

PMID Text
26791953 We demonstrate that an hnRNPA1 and CBX5 bi-directional core promoter fragment does not comprise intrinsic capacity for specific CBX5 down-regulation in metastatic cells
26157143 PIP5K1A modulates ribosomal RNA gene silencing through its interaction with histone H3 lysine 9 trimethylation and heterochromatin protein HP1-alpha.
25960296 Identify a nuclear localization signal within the 462-494 amino acid region of TRIM28 that overlaps with its HP1 binding site. GST-pulldown experiments revealed the interaction of the arginine-rich TRIM28 NLS with various importin alpha subtypes.
25945750 Jra recruits the HP1a/KDM4A complex to its gene body region upon osmotic stress to reduce H3K36 methylation levels and disrupt H3K36 methylation-dependent histone deacetylation
25934638 a considerable number of alternative splicing events could have a chromatin-dependent regulation involving the association of HP1alpha and CTCF near regulated exons.
25818296 SET interacts with the Kruppel-associated box (KRAB)-associated co-repressor KAP1, and its overexpression results in the sustained retention of KAP1 and Heterochromatin protein 1 (HP1) on chromatin
25704815 HP1 regulates this gene's alternative splicing in a methylation-dependent manner by recruiting splicing factors to its methylated form.
25588582 HP1alpha plays an important role in the differentiation and angiogenic function of Endothelial Progenitor Cells.
25519718 Paternal heterochromatin formation in human embryos is H3K9/HP1 directed and primed by sperm-derived histone modifications.
25384975 RAD6 physically interacts with heterochromatin protein 1alpha and ubiquitinates HP1alpha at residue K154, thereby promoting heterochromatin protein 1alpha degradation through the autophagy pathway
25332400 The results suggested that HP1 phosphorylation has an evolutionarily conserved role in HP1's recognition of H3K9me-marked nucleosomes.
25104354 Spatiotemporal dynamics of HP1A localization to centromere is governed by two distinct structural determinants.
25092915 Data show that RRP1B regulates metastasis associated gene expression by interacting with the transcriptional corepressors TRIM28 and HP1a, which act by recruiting chromatin-modifying enzymes.
24917673 These findings reveal a previously unrecognized but direct link between HP1 and CPC localization in the centromere and illustrate the critical role of borealin-HP1 interaction in orchestrating an accurate cell division.
24840329 Data suggest the reduction of Heterochromatin Protein 1 isoforms HP1beta followed by a decrease in HP1alpha contributes to the pathogenesis of thyroid carcinomas, and their loss is a potential marker of thyroid malignancy and metastatic potential, respectively.
24825911 Heterochromatin protein 1 (HP1) is an evolutionarily conserved chromosomal protein that binds lysine 9-methylated histone H3 (H3K9me), a hallmark of heterochromatin, and plays a crucial role in forming higher-order chromatin structures.
24820035 Binding of HP1alpha, HP1beta, and HP1gamma to the globular domain of histone H3 is differentially regulated by phosphorylation of residues H3T45 and H3S57.
24786771 The phosphorylation-dephosphorylation cycle of HP1alpha orchestrates accurate progression of cells through mitosis.
24561205 CTCF may regulate vigilin behavior and thus indirectly influence the binding of HP1alpha to the satellite 2 locus.
24415761 these findings demonstrate that HP1(Hsalpha)-nucleosome interactions cause chromatin condensation, a process that regulates many chromosome events.
24292684 CRL4B promotes tumorigenesis by coordinating with SUV39H1/HP1/DNMT3A in DNA methylation-based epigenetic silencing
23803414 HIV-1 Vpr actively recruits p300/HAT to a range of chromatin regions including the centromere, resulting in the displacement of HP1-alpha
23645696 Nucleus-localized tyrosine kinases, including Src family kinases, phosphorylate KAP1 and inhibit the association of KAP1 and HP1alpha with heterochromatin.
23392382 HP1alpha mutation W174A, which disrupts interactions with proteins containing the PxVxL motif did not affect interactions with the BZip protein. The HP1alpha W41A mutation, which prevents binding to methylated histones, exhibited greatly reduced FRET efficiency.
23287531 study finds that while HP1apha and beta stimulate homologous recombination and single-strand annealing, HP1gamma has an inhibitory role
23142645 The hinge region (HR) connecting the CD and C-terminal chromoshadow domain (CSD), and the CSD contributed to the selective binding of HP1alpha to histone H3 with trimethylated lysine 9 through weak DNA binding and by suppressing the DNA binding, respectively.
23142018 HP-1alpha/beta may be useful in the differential diagnosis of renal tumors, especially in the differentiation of chromophobe RCC and oncocytoma
23028349 HP1-alpha and PADI4 are regulators of both immune genes and HERVs, and that multiple events of transcriptional reactivation in Multiple Sclerosis patients can be explained by the deficiency of a single mechanism of gene silencing.
22922742 Downregulation of the telomeric noncoding RNA requires SUV39H1 and HP1A.
22900142 We have identified CBX5 as a potential target regulating lung cancer survivals and the stem-like properties of lung CD133+- tumor stem-like cells (TSLCs).
22318730 These studies reveal a novel role for HP1 as a cofactor in tumor suppression, expand our mechanistic understanding of a KLF associated to human disease.
22234250 HP1 increases the chromatin association of VHL.
22205726 HP1-dependent regulation of KAP1 influences DNA repair in heterochromatin.
21875947 HIV-1 Vpr displaces heterochromatin protein 1-alpha and heterochromatin protein 1-gamma from chromatin, resulting in premature chromatid separation.
21875947 HIV-1 Vpr actively recruits p300/HAT to a range of chromatin regions including the centromere, resulting in the displacement of HP1-alpha
21374739 The finding that HP1 alpha is down-regulated primarily at the transcriptional level provides a new insight for the further elucidation of the detailed molecular mechanisms causing the HP1 alpha down-regulation in invasive breast cancer cells.
21364188 A link between mutant codanin-1 and the aberrant localization of HP1 alpha is supported by the finding that codanin-1 can be coimmunoprecipitated by anti-HP1 alpha antibodies erythroblasts from patients with congenital dyserythropoietic anemia type 1.
21346195 HP1alpha binding by INCENP or Shugoshin 1 (Sgo1) is dispensable for centromeric cohesion protection during mitosis of human cells, but might regulate yet unknown interphase functions of the chromosome passenger complex (CPC) or Sgo1 at the centromeres.
20695923 we show distinct cell-type- and cancer-stage-associated patterns of key heterochromatin marks: heterochromatic adaptor proteins HP1alpha and HP1gamma, compared with the gammaH2AX marker of endogenously activated DNA damage response.
20562864 The results reveal POGZ as an essential protein that links HP1alpha dissociation with Aurora B kinase activation during mitosis.
20498703 Mislocalized lamins can induce ubiquitin-mediated proteasomal degradation of certain HP1 isoforms by activation of FBXW10, a member of the F-box family of proteins that is involved in E3 ubiquitin ligase activity.
20421743 Recent findings and controversies concerning HP1 functions in mammalian cells in comparison to studies in other organisms, are reviewed.
20231385 The assembly of HP1 in the inner centromere and the localization of hMis14 at the kinetochore are mutually dependent in human chromosomes.
20154359 ATRX185 is required for HP1a deposition in pericentric beta-heterochromatin of the X chromosome
20049717 HP1alpha expression regulation is dependent on cell proliferation.
20011120 data suggest that HP1 chromoshadow-domains can benefit from the opening of nucleosomal structures to bind chromatin and that HP1 proteins use this property to detect and arrest unwanted chromatin remodeling
19783980 Heterochromatin protein 1alpha (HP1alpha), but not HP1beta, specifically binds to Tyr 41 region of H3 through its chromo-shadow domain; phosphorylation of H3Y41 by JAK2 prevents this binding
19617346 Data demonstrate that hnRNP U is involved in HP1alpha function, shedding new light on the mode of action of HP1alpha and on the function of hnRNP U.
19567367 Heterochromatin protein 1 is extensively decorated with histone code-like post-translational modifications
19566924 reduction of YY1 expression in breast cancer cells could contribute to the acquisition of an invasive phenotype through increased cell migration as well as by reduced expression of HP1alpha
19498464 The histone H3K9 methyltransferase SetDB1 associates with the specific heterochromatin protein 1alpha (HP1alpha)-chromatin assembly factor 1 (CAF1) chaperone complex.
19479850 HP1 is recruited to the damaged regions in hetero- as well as euchromatin within a few minutes after damage.
19352502 results show no evidence for a requirement of HP1 proteins for either loading of bulk cohesin onto chromatin in interphase or retention of cohesin at pericentric heterochromatin in mitosis
18809684 G9a and HP1 couple histone and DNA methylation to TNFalpha transcription silencing during endotoxin tolerance
18676401 The histone subcode: poly(ADP-ribose) polymerase-1 (Parp-1) and Parp-2 control cell differentiation by regulating the transcriptional intermediary factor TIF1beta and the heterochromatin protein HP1alpha
18264112 HP1-mediated inhibition of preinitiation complex (PIC) assembly in vitro on chromatin templates regulated by GAL4-VP16 or Sp1, is analyzed.
17470536 Direct interactions between HP1 and DNMT1 mediate silencing of euchromatic genes.
17381543 In non-differentiated cells, transcriptional intermediary factor TIF1beta/heterochromatin protein HP1 interaction occurs only within euchromatin and involves selectively HP1beta and HP1gamma, but not HP1alpha.
17101789 These data indicate that defects in pericentromeric epigenetic heterochromatin modifications initiate a dynamic HP1-dependent response that rescues pericentromeric heterochromatin function and is essential for viable progression through mitosis.
16762841 Phosphorylation of the linker histone H1 by CDK regulates its binding to HP1alpha
16648629 modulation of HP1(Hsalpha) alters the invasive potential of breast cancer cells through mechanisms requiring HP1 dimerization
16487625 Results describe the predominant nuclear localization of another Arp subfamily, Arp6, in vertebrate cells, and show its colocalization with heterochromatin protein 1 orthologs in pericentric heterochromatin.
15899859 HP1alpha recruits endogenous HP1beta to the chromatin and this induces heterochromatin formation and enhanced histone lysine methylation.
15454574 HP1 has a role in the recruitment but not in the stable association of Orc1p with heterochromatin
14585993 cells are exquisitely sensitive to the amount of HP1(Hsalpha) or HP1(Hsbeta) present, as their overexpression influences telomere stability, population doubling time, radioresistance, and tumorigenicity
12711603 histone H3 methylase Suv39h1 and the methyl lysine-binding protein HP1alpha directly interact with MBD of MBD1 in vitro and in cells
12692243 HIV-1 Vpr actively recruits p300/HAT to a range of chromatin regions including the centromere, resulting in the displacement of HP1-alpha
12560555 the chromodomain and the chromoshadow domain of HP1 are both required for binding to native chromatin in vivo, but they contribute differentially to binding in euchromatin and heterochromatin
12414990 developmentally regulated ARL5, with its distinctive nuclear/nucleolar localization and interaction with HP1alpha, may play a role(s) in nuclear dynamics and/or signaling cascades during embryonic development
12411497 identification of three amino acid residues I113, A114 and C133 in HP1alpha that are essential for the selective interaction of HP1alpha with BRG1
12054505 Gene regulation by human orthologs of Drosophila heterochromatin protein 1.
11942629 These results suggested that, although the majority of HP1alpha diffuses into the cytoplasm, some populations are retained in the centromeric region and involved in the association and segregation of sister kinetochores during mitosis.

AA Sequence

MGKKTKRTADSSSSEDEEEYVVEKVLDRRVVKGQVEYLLKWKGFSEEHNTWEPEKNLDCPELISEFMKKY      1 - 70
KKMKEGENNKPREKSESNKRKSNFSNSADDIKSKKKREQSNDIARGFERGLEPEKIIGATDSCGDLMFLM     71 - 140
KWKDTDEADLVLAKEANVKCPQIVIAFYEERLTWHAYPEDAENKEKETAKS                       141 - 191
//

Text Mined References (141)

PMID Year Title
27107012 2016 Pooled-matrix protein interaction screens using Barcode Fusion Genetics.
26791953 2016 Regulatory dissection of the CBX5 and hnRNPA1 bi-directional promoter in human breast cancer cells reveals novel transcript variants differentially associated with HP1? down-regulation in metastatic cells.
26157143 2015 Phosphatidylinositol-4-phosphate 5-Kinase 1? Modulates Ribosomal RNA Gene Silencing through Its Interaction with Histone H3 Lysine 9 Trimethylation and Heterochromatin Protein HP1-?.
25960296 2015 Identification and characterization of a nuclear localization signal of TRIM28 that overlaps with the HP1 box.
25945750 2015 HP1a/KDM4A is involved in the autoregulatory loop of the oncogene gene c-Jun.
25934638 2015 A chromatin code for alternative splicing involving a putative association between CTCF and HP1? proteins.
25818296 2015 The nuclear oncogene SET controls DNA repair by KAP1 and HP1 retention to chromatin.
25772364 2015 SUMO-2 Orchestrates Chromatin Modifiers in Response to DNA Damage.
25755297 2015 System-wide Analysis of SUMOylation Dynamics in Response to Replication Stress Reveals Novel Small Ubiquitin-like Modified Target Proteins and Acceptor Lysines Relevant for Genome Stability.
25704815 2015 HP1 is involved in regulating the global impact of DNA methylation on alternative splicing.
25588582 2015 Heterochromatin Protein 1 Alpha (HP1?: CBX5) is a Key Regulator in Differentiation of Endothelial Progenitor Cells to Endothelial Cells.
25519718 2014 Paternal heterochromatin formation in human embryos is H3K9/HP1 directed and primed by sperm-derived histone modifications.
25384975 2015 RAD6 promotes homologous recombination repair by activating the autophagy-mediated degradation of heterochromatin protein HP1.
25332400 2014 N-terminal phosphorylation of HP1? increases its nucleosome-binding specificity.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
25104354 2014 The spatiotemporal dynamics of chromatin protein HP1? is essential for accurate chromosome segregation during cell division.
25092915 2014 Metastasis-associated protein ribosomal RNA processing 1 homolog B (RRP1B) modulates metastasis through regulation of histone methylation.
24917673 2014 Chromatin protein HP1 interacts with the mitotic regulator borealin protein and specifies the centromere localization of the chromosomal passenger complex.
24840329 2014 Heterochromatin protein 1 expression is reduced in human thyroid malignancy.
24825911 2014 Biochemical and structural properties of heterochromatin protein 1: understanding its role in chromatin assembly.
24820035 2014 DYRK1A phoshorylates histone H3 to differentially regulate the binding of HP1 isoforms and antagonize HP1-mediated transcriptional repression.
24786771 2014 Phosphorylation-dephosphorylation cycle of HP1? governs accurate mitotic progression.
24561205 2014 CTCF-mediated reduction of vigilin binding affects the binding of HP1? to the satellite 2 locus.
24415761 2014 Human heterochromatin protein 1? promotes nucleosome associations that drive chromatin condensation.
24292684 2015 CRL4B promotes tumorigenesis by coordinating with SUV39H1/HP1/DNMT3A in DNA methylation-based epigenetic silencing.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24018422 2013 The deSUMOylase SENP7 promotes chromatin relaxation for homologous recombination DNA repair.
23797873 2013 SET-domain bacterial effectors target heterochromatin protein 1 to activate host rDNA transcription.
23645696 2013 Phosphorylation of KRAB-associated protein 1 (KAP1) at Tyr-449, Tyr-458, and Tyr-517 by nuclear tyrosine kinases inhibits the association of KAP1 and heterochromatin protein 1? (HP1?) with heterochromatin.
23392382 2013 Unraveling transcription factor interactions with heterochromatin protein 1 using fluorescence lifetime imaging microscopy and fluorescence correlation spectroscopy.
23287531 2013 Differential contribution of HP1 proteins to DNA end resection and homology-directed repair.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23142645 2013 Hinge and chromoshadow of HP1? participate in recognition of K9 methylated histone H3 in nucleosomes.
23142018 2013 The expression of heterochromatin protein 1?/? in the kidney tumors: a microarray immunohistochemical study.
23028349 2012 Citrullination of histone H3 interferes with HP1-mediated transcriptional repression.
22922742 2012 Telomere length regulates TERRA levels through increased trimethylation of telomeric H3K9 and HP1?.
22900142 2012 Network biology of tumor stem-like cells identified a regulatory role of CBX5 in lung cancer.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22318730 2012 Sequence-specific recruitment of heterochromatin protein 1 via interaction with Krüppel-like factor 11, a human transcription factor involved in tumor suppression and metabolic diseases.
22234250 2012 The interaction of the von Hippel-Lindau tumor suppressor and heterochromatin protein 1.
22205726 2012 The ATM substrate KAP1 controls DNA repair in heterochromatin: regulation by HP1 proteins and serine 473/824 phosphorylation.
22139419 2011 New gene functions in megakaryopoiesis and platelet formation.
21900206 2011 A directed protein interaction network for investigating intracellular signal transduction.
21888893 2011 Analysis of the human HP1 interactome reveals novel binding partners.
21875947 2011 Epigenetic displacement of HP1 from heterochromatin by HIV-1 Vpr causes premature sister chromatid separation.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21374739 2011 Analysis of HP1? regulation in human breast cancer cells.
21364188 2011 Codanin-1 mutations in congenital dyserythropoietic anemia type 1 affect HP1{alpha} localization in erythroblasts.
21346195 2011 Mitotic centromeric targeting of HP1 and its binding to Sgo1 are dispensable for sister-chromatid cohesion in human cells.
21269460 2011 Initial characterization of the human central proteome.
21047797 2011 Recognition and specificity determinants of the human cbx chromodomains.
21029866 2010 Nucleosome-interacting proteins regulated by DNA and histone methylation.
20871592 2010 Methyl-H3K9-binding protein MPP8 mediates E-cadherin gene silencing and promotes tumour cell motility and invasion.
20850016 2010 Quantitative interaction proteomics and genome-wide profiling of epigenetic histone marks and their readers.
20695923 2011 Heterochromatin marks HP1?, HP1? and H3K9me3, and DNA damage response activation in human testis development and germ cell tumours.
20562864 2010 Human POGZ modulates dissociation of HP1alpha from mitotic chromosome arms through Aurora B activation.
20498703 2010 Lamin A rod domain mutants target heterochromatin protein 1alpha and beta for proteasomal degradation by activation of F-box protein, FBXW10.
20421743 2010 HP1: heterochromatin binding proteins working the genome.
20231385 2010 Inner centromere formation requires hMis14, a trident kinetochore protein that specifically recruits HP1 to human chromosomes.
20154359 2010 Protein complex of Drosophila ATRX/XNP and HP1a is required for the formation of pericentric beta-heterochromatin in vivo.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
20049717 2009 Heterochromatin protein 1alpha: a hallmark of cell proliferation relevant to clinical oncology.
20042602 2010 The middle region of an HP1-binding protein, HP1-BP74, associates with linker DNA at the entry/exit site of nucleosomal DNA.
20011120 2009 Interaction of HP1 and Brg1/Brm with the globular domain of histone H3 is required for HP1-mediated repression.
19880879 2010 ASXL1 represses retinoic acid receptor-mediated transcription through associating with HP1 and LSD1.
19834512 2009 Structural basis for recognition of H3K4 methylation status by the DNA methyltransferase 3A ATRX-DNMT3-DNMT3L domain.
19783980 2009 JAK2 phosphorylates histone H3Y41 and excludes HP1alpha from chromatin.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19666599 2009 Human BAHD1 promotes heterochromatic gene silencing.
19617346 2009 Physical and functional interaction between heterochromatin protein 1alpha and the RNA-binding protein heterogeneous nuclear ribonucleoprotein U.
19567367 2009 Heterochromatin protein 1 is extensively decorated with histone code-like post-translational modifications.
19566924 2009 The role of YY1 in reduced HP1alpha gene expression in invasive human breast cancer cells.
19498464 2009 The HP1alpha-CAF1-SetDB1-containing complex provides H3K9me1 for Suv39-mediated K9me3 in pericentric heterochromatin.
19486527 2009 The histone methyltransferase SUV420H2 and Heterochromatin Proteins HP1 interact but show different dynamic behaviours.
19479850 2009 Recruitment of heterochromatin protein 1 to DNA repair sites.
19352502 2009 Heterochromatin protein 1 (HP1) proteins do not drive pericentromeric cohesin enrichment in human cells.
19135898 2009 Purification of proteins associated with specific genomic Loci.
18809684 2008 G9a and HP1 couple histone and DNA methylation to TNFalpha transcription silencing during endotoxin tolerance.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18676401 2008 The histone subcode: poly(ADP-ribose) polymerase-1 (Parp-1) and Parp-2 control cell differentiation by regulating the transcriptional intermediary factor TIF1beta and the heterochromatin protein HP1alpha.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18264112 2008 HP1-mediated silencing targets Pol II coactivator complexes.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17470536 2007 Functional cooperation between HP1 and DNMT1 mediates gene silencing.
17381543 2007 Dynamic and selective interactions of the transcriptional corepressor TIF1 beta with the heterochromatin protein HP1 isotypes during cell differentiation.
17213182 2006 Identification of genes related to Parkinson's disease using expressed sequence tags.
17101789 2007 HP1 proteins are essential for a dynamic nuclear response that rescues the function of perturbed heterochromatin in primary human cells.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16762841 2006 Phosphorylation of the linker histone H1 by CDK regulates its binding to HP1alpha.
16751776 2006 A germline-specific class of small RNAs binds mammalian Piwi proteins.
16648629 2006 A requirement for dimerization of HP1Hsalpha in suppression of breast cancer invasion.
16487625 2006 Vertebrate Arp6, a novel nuclear actin-related protein, interacts with heterochromatin protein 1.
16415788 2006 Tudor, MBT and chromo domains gauge the degree of lysine methylation.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
16177824 2005 Mediation of Epstein-Barr virus EBNA-LP transcriptional coactivation by Sp100.
16127177 2005 HP1 binds specifically to Lys26-methylated histone H1.4, whereas simultaneous Ser27 phosphorylation blocks HP1 binding.
15899859 2005 In vivo HP1 targeting causes large-scale chromatin condensation and enhanced histone lysine methylation.
15882967 2005 The mammalian heterochromatin protein 1 binds diverse nuclear proteins through a common motif that targets the chromoshadow domain.
15864296 2005 Dissociation of heterochromatin protein 1 from lamin B receptor induced by human polyomavirus agnoprotein: role in nuclear egress of viral particles.
15635413 2005 Nucleolar proteome dynamics.
15502821 2004 A conserved Mis12 centromere complex is linked to heterochromatic HP1 and outer kinetochore protein Zwint-1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15454574 2004 Subnuclear distribution of the largest subunit of the human origin recognition complex during the cell cycle.
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
15196694 2004 Human follitropin receptor (FSHR) interacts with the adapter protein 14-3-3tau.
14730304 2004 Lamr1 functional retroposon causes right ventricular dysplasia in mice.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14585993 2003 Human heterochromatin protein 1 isoforms HP1(Hsalpha) and HP1(Hsbeta) interfere with hTERT-telomere interactions and correlate with changes in cell growth and response to ionizing radiation.
12867029 2003 Suv39h-mediated histone H3 lysine 9 methylation directs DNA methylation to major satellite repeats at pericentric heterochromatin.
12711603 2003 Methyl-CpG binding domain 1 (MBD1) interacts with the Suv39h1-HP1 heterochromatic complex for DNA methylation-based transcriptional repression.
12692243 2003 Recruitment of Tat to heterochromatin protein HP1 via interaction with CTIP2 inhibits human immunodeficiency virus type 1 replication in microglial cells.
12565857 2003 Self-interaction of heterochromatin protein 1 is required for direct binding to histone methyltransferase, SUV39H1.
12560555 2003 Maintenance of stable heterochromatin domains by dynamic HP1 binding.
12485163 2002 Interaction of the chromatin compaction-inducing domain (LR domain) of Ki-67 antigen with HP1 proteins.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12414990 2002 A developmentally regulated ARF-like 5 protein (ARL5), localized to nuclei and nucleoli, interacts with heterochromatin protein 1.
12411497 2002 Selective interaction between the chromatin-remodeling factor BRG1 and the heterochromatin-associated protein HP1alpha.
12242305 2002 Association of class II histone deacetylases with heterochromatin protein 1: potential role for histone methylation in control of muscle differentiation.
12154074 2002 Cell differentiation induces TIF1beta association with centromeric heterochromatin via an HP1 interaction.
12054505 2002 Gene regulation by human orthologs of Drosophila heterochromatin protein 1.
11959914 2002 Isoform-specific interaction of HP1 with human TAFII130.
11942629 2001 Molecular behavior in living mitotic cells of human centromere heterochromatin protein HPLalpha ectopically expressed as a fusion to red fluorescent protein.
11336697 2001 Heterochromatin formation in mammalian cells: interaction between histones and HP1 proteins.
11313457 2001 Common properties of nuclear body protein SP100 and TIF1alpha chromatin factor: role of SUMO modification.
11242054 2001 Selective recognition of methylated lysine 9 on histone H3 by the HP1 chromo domain.
11242053 2001 Methylation of histone H3 lysine 9 creates a binding site for HP1 proteins.
11112778 2001 Human Ku70 interacts with heterochromatin protein 1alpha.
10938122 2000 Molecular determinants for targeting heterochromatin protein 1-mediated gene silencing: direct chromoshadow domain-KAP-1 corepressor interaction is essential.
10882726 2000 Heterochromatin protein 1 binds to nucleosomes and DNA in vitro.
10699177 2000 Cell cycle-dependent phosphorylation of the ATRX protein correlates with changes in nuclear matrix and chromatin association.
10562550 1999 Interaction with members of the heterochromatin protein 1 (HP1) family and histone deacetylation are differentially involved in transcriptional silencing by members of the TIF1 family.
10460410 1999 Localization and phosphorylation of HP1 proteins during the cell cycle in mammalian cells.
10330177 1999 KAP-1 corepressor protein interacts and colocalizes with heterochromatic and euchromatic HP1 proteins: a potential role for Krüppel-associated box-zinc finger proteins in heterochromatin-mediated gene silencing.
9864353 1998 INCENP centromere and spindle targeting: identification of essential conserved motifs and involvement of heterochromatin protein HP1.
9636147 1998 Chromatin components as part of a putative transcriptional repressing complex.
9636146 1998 Interaction of SP100 with HP1 proteins: a link between the promyelocytic leukemia-associated nuclear bodies and the chromatin compartment.
9454751 1998 Stage-specific expression of polycomb group genes in human bone marrow cells.
9169472 1997 Domain-specific interactions of human HP1-type chromodomain proteins and inner nuclear membrane protein LBR.
8864858 1996 Human homolog of Drosophila heterochromatin-associated protein 1 (HP1) is a DNA-binding protein which possesses a DNA-binding motif with weak similarity to that of human centromere protein C (CENP-C).
8663349 1996 Interaction between an integral protein of the nuclear envelope inner membrane and human chromodomain proteins homologous to Drosophila HP1.
8505380 1993 Molecular cloning of a human homologue of Drosophila heterochromatin protein HP1 using anti-centromere autoantibodies with anti-chromo specificity.