Property Summary

NCBI Gene PubMed Count 44
PubMed Score 17.37
PubTator Score 120.24

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
Rheumatoid Arthritis 1.100 4.8e-02
osteosarcoma 1.263 2.8e-03
atypical teratoid / rhabdoid tumor 1.600 1.7e-03
glioblastoma 1.600 8.9e-05
medulloblastoma 1.400 2.6e-03
medulloblastoma, large-cell 1.100 8.3e-05
primitive neuroectodermal tumor 1.600 7.5e-05
juvenile dermatomyositis 2.170 2.1e-13
tuberculosis and treatment for 6 months 1.400 6.1e-06
intraductal papillary-mucinous neoplasm ... 2.000 3.7e-03
Breast cancer 2.700 4.2e-02
ductal carcinoma in situ 1.100 2.2e-03
invasive ductal carcinoma 2.100 2.1e-03
ulcerative colitis 1.700 3.6e-06
ovarian cancer 2.400 7.9e-08

Gene RIF (21)

PMID Text
25766328 Cbx4 is an independent prognostic factor for HCC patients, and the patients with high Cbx4 expression should receive postoperative TACE treatment to improve their survival
25607636 our study demonstrated that miR-195 acts as a tumor suppressor by directly targeting CBX4 in hepatocellular carcinoma
24838576 Role of Cbx4 in migration and metastasis of a metastatic hepatocellular carcinoma cell line. Results show that Cbx4 overexpression increases the in vitro vessel formation of vascular endothelial cells in its SUMO interaction motifs-dependent manner.
24460908 The presence of CBX4-GFP in the same focus had a minor impact on BMI1 and RING1 recovery kinetics.
24434214 our findings demonstrate that Cbx4 plays a critical role in tumor angiogenesis by governing HIF-1alpha protein
23943028 High cytoplasmic expression of CBX4 is associated with hepatocellular carcinoma.
22897849 ASXL1 associates with the PRC2 and loss of ASXL1 in vivo collaborates with NRASG12D to promote myeloid leukemogenesis.
22078878 Pc2, methylation controls the protein's interaction with two distinct ncRNAs, TUG1 and NEAT2, which results in the exclusive subnuclear localization of methylated and unmethylated Pc2 in Polycomb bodies and interchromatin granules, respectively.
22028491 High Polycomb repressive complex protein is associated with mesothelioma.
21885019 plays role in regulation of epidermal stem cell proliferation and senescence
21549310 Data show that PRC2 can integrate information provided by pre-existing histone modifications to accurately tune its enzymatic activity within a particular chromatin context.
21282530 14-3-3 protein binding to chromobox homolog 4 (CBX4) appears to modulate the interaction between CBX4 and the BMI1/PCGF components of polycomb recessive complex 1, but has no effect on CBX4-RING1/RNF2 interaction
21256122 the hPc2-induced SUMOylation of alpha-synuclein could function as a cytoprotector by increasing alpha-synuclein aggregate formation within fibroblast cells.
19933700 Huntingtin is a novel stimulator of polycomb repressive complex 2.
19336002 A phage display screen using the N-terminus of JARID1B as bait identified one of the JARID1B interacting proteins, namely PcG protein (Polycomb group) hPc2.
18567530 Results show that DNA methyltransferase 3B enhances polycomb protein 2-mediated transcriptional repression of FGFR3, and suggest that DNMT3B is a co-repressor of hPc2 in inducing transcriptional repression independent of DNA methylation.
18178578 The Endoplasmic reticulum-associated degradation (ERAD) machinery may thus be important for autosomal dominant polycystic kidney disease pathogenesis because the regulation of PC2 expression by the ERAD pathway is altered by mutations in PC2.
17018294 Pc2 binds to and colocalizes with homeodomain interacting protein kinase 2 (HIPK2) and serves as a SUMO E3 ligase for this kinase.
16061479 SIP1 sumoylation by Pc2 attenuates transcriptional repression of E-cadherin
15710417 polycomb group (PcG) protein HPC2, which functions as a transcriptional suppressor, is a candidate of KyoT2-binding proteins
12679040 Pc2 dramatically enhances CtBP sumoylation. Pc2 is a SUMO E3, and Polycomb Group bodies may be sumoylation centers.

AA Sequence

MELPAVGEHVFAVESIEKKRIRKGRVEYLVKWRGWSPKYNTWEPEENILDPRLLIAFQNRERQEQLMGYR      1 - 70
KRGPKPKPLVVQVPTFARRSNVLTGLQDSSTDNRAKLDLGAQGKGQGHQYELNSKKHHQYQPHSKERAGK     71 - 140
PPPPGKSGKYYYQLNSKKHHPYQPDPKMYDLQYQGGHKEAPSPTCPDLGAKSHPPDKWAQGAGAKGYLGA    141 - 210
VKPLAGAAGAPGKGSEKGPPNGMMPAPKEAVTGNGIGGKMKIVKNKNKNGRIVIVMSKYMENGMQAVKIK    211 - 280
SGEVAEGEARSPSHKKRAADERHPPADRTFKKAAGAEEKKVEAPPKRREEEVSGVSDPQPQDAGSRKLSP    281 - 350
TKEAFGEQPLQLTTKPDLLAWDPARNTHPPSHHPHPHPHHHHHHHHHHHHAVGLNLSHVRKRCLSETHGE    351 - 420
REPCKKRLTARSISTPTCLGGSPAAERPADLPPAAALPQPEVILLDSDLDEPIDLRCVKTRSEAGEPPSS    421 - 490
LQVKPETPASAAVAVAAAAAPTTTAEKPPAEAQDEPAESLSEFKPFFGNIIITDVTANCLTVTFKEYVTV    491 - 560
//

Text Mined References (55)

PMID Year Title
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
25772364 2015 SUMO-2 Orchestrates Chromatin Modifiers in Response to DNA Damage.
25766328 2015 Prognostic significance of Cbx4 expression and its beneficial effect for transarterial chemoembolization in hepatocellular carcinoma.
25755297 2015 System-wide Analysis of SUMOylation Dynamics in Response to Replication Stress Reveals Novel Small Ubiquitin-like Modified Target Proteins and Acceptor Lysines Relevant for Genome Stability.
25607636 2015 MicroRNA-195 functions as a tumor suppressor by inhibiting CBX4 in hepatocellular carcinoma.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
24838576 2014 Polycomb chromobox 4 enhances migration and pulmonary metastasis of hepatocellular carcinoma cell line MHCC97L.
24528284 2014 Citalopram and escitalopram plasma drug and metabolite concentrations: genome-wide associations.
24460908 2014 PRC1 components exhibit different binding kinetics in Polycomb bodies.
24434214 2014 Cbx4 governs HIF-1? to potentiate angiogenesis of hepatocellular carcinoma by its SUMO E3 ligase activity.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23943028 2013 Chromobox homolog 4 is correlated with prognosis and tumor cell growth in hepatocellular carcinoma.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22897849 2012 ASXL1 mutations promote myeloid transformation through loss of PRC2-mediated gene repression.
22825850 2012 DNA damage-induced heterogeneous nuclear ribonucleoprotein K sumoylation regulates p53 transcriptional activation.
22467880 2012 Small ubiquitin-like modifier (SUMO) modification of zinc finger protein 131 potentiates its negative effect on estrogen signaling.
22078878 2011 ncRNA- and Pc2 methylation-dependent gene relocation between nuclear structures mediates gene activation programs.
22028491 2012 Polycomb repressor complex-2 is a novel target for mesothelioma therapy.
21885019 2011 Regulation of human epidermal stem cell proliferation and senescence requires polycomb- dependent and -independent functions of Cbx4.
21549310 2011 Histone methylation by PRC2 is inhibited by active chromatin marks.
21282530 2011 Interaction proteomics analysis of polycomb proteins defines distinct PRC1 complexes in mammalian cells.
21256122 2011 Human Polycomb protein 2 promotes ?-synuclein aggregate formation through covalent SUMOylation.
20601937 2010 Ubiquitin-specific proteases 7 and 11 modulate Polycomb regulation of the INK4a tumour suppressor.
20176810 2010 The SUMO E3 ligase activity of Pc2 is coordinated through a SUMO interaction motif.
20098713 2010 A role for non-covalent SUMO interaction motifs in Pc2/CBX4 E3 activity.
19933700 2010 Huntingtin facilitates polycomb repressive complex 2.
19636380 2009 Several distinct polycomb complexes regulate and co-localize on the INK4a tumor suppressor locus.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19336002 2009 The PcG protein hPc2 interacts with the N-terminus of histone demethylase JARID1B and acts as a transcriptional co-repressor.
19266028 2009 Genome-wide analysis of histidine repeats reveals their role in the localization of human proteins to the nuclear speckles compartment.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18567530 2008 DNA methyltransferase 3B acts as a co-repressor of the human polycomb protein hPc2 to repress fibroblast growth factor receptor 3 transcription.
18178578 2008 Polycystin-2 is regulated by endoplasmic reticulum-associated degradation.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17332741 2007 Bypass of senescence by the polycomb group protein CBX8 through direct binding to the INK4A-ARF locus.
17087506 2006 Human cystathionine beta-synthase is a target for sumoylation.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
17018294 2006 Phosphorylation-dependent control of Pc2 SUMO E3 ligase activity by its substrate protein HIPK2.
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
16169070 2005 A human protein-protein interaction network: a resource for annotating the proteome.
16061479 2005 Pc2-mediated sumoylation of Smad-interacting protein 1 attenuates transcriptional repression of E-cadherin.
15710417 2005 The PcG protein HPC2 inhibits RBP-J-mediated transcription by interacting with LIM protein KyoT2.
15592428 2005 Multiple activities contribute to Pc2 E3 function.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12679040 2003 The polycomb protein Pc2 is a SUMO E3.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12167701 2002 The core of the polycomb repressive complex is compositionally and functionally conserved in flies and humans.
12101246 2002 Selective interactions between vertebrate polycomb homologs and the SUV39H1 histone lysine methyltransferase suggest that histone H3-K9 methylation contributes to chromosomal targeting of Polycomb group proteins.
11583618 2001 Linking the Rb and polycomb pathways.
9858600 1999 C-Terminal binding protein is a transcriptional repressor that interacts with a specific class of vertebrate Polycomb proteins.
9858531 1999 RING1 interacts with multiple Polycomb-group proteins and displays tumorigenic activity.
9367786 1997 MPc2, a new murine homolog of the Drosophila polycomb protein is a member of the mouse polycomb transcriptional repressor complex.
9315667 1997 Interference with the expression of a novel human polycomb protein, hPc2, results in cellular transformation and apoptosis.
9199346 1997 RING1 is associated with the polycomb group protein complex and acts as a transcriptional repressor.