Property Summary

NCBI Gene PubMed Count 25
PubMed Score 21.14
PubTator Score 38.70

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
ependymoma 1.900 1.9e-11
glioblastoma 2.800 7.3e-06
medulloblastoma 3.700 8.0e-10
atypical teratoid / rhabdoid tumor 3.200 7.6e-13
medulloblastoma, large-cell 3.600 2.1e-08
primitive neuroectodermal tumor 3.900 1.2e-07
non-small cell lung cancer 1.768 7.1e-13
pediatric high grade glioma 2.100 3.1e-06
Breast cancer 2.000 1.3e-06
ductal carcinoma in situ 1.200 1.6e-03
invasive ductal carcinoma 2.300 1.4e-02
ovarian cancer 1.900 3.8e-08
psoriasis 1.100 5.2e-43

Gene RIF (9)

PMID Text
26877821 up-regulated in metastatic castration-resistant prostate cancer and elevated expression correlates with poor clinical outcome
26431491 Data show that basal-like subgroup was enriched for aggressive tumors and somatic mutations in trithorax-group genes and it overexpressed polycomb genes EZH2 and CBX2.
25569159 CBX2 role in the sex development cascade is to stimulate the male pathway and concurrently inhibit the female pathway.
25225902 CBX2 upregulation and amplification significantly correlated with metastatic progression and lower overall survival in many cancer types, particularly those of the breast
23219007 This study does not support CBX2 gene disruption as a common cause of gonadal gonadal disorders of sex development.
22632162 Both HIV-1 Tat 47-59 and FITC-labeled Tat 47-59 peptides downregulate gene expression of chromobox homolog 2 (CBX2) in U-937 macrophages
22419124 Two distinct mechanisms are involved in CBX2-mediated gene silencing. The short CBX2-2 isoform would repress the transcription in a PRC1-independent fashion, whereas gene repression by the long CBX2-1 isoform is mediated by the PRC1 protein complex.
22009739 CDYL functions as a molecular bridge between PRC2 and the repressive chromatin mark H3K27me3, forming a positive feedback loop to facilitate the establishment and propagation of H3K27me3 modifications along the chromatin
19107218 hPc2 serves as a SUMO E3 ligase for cystathionine beta-synthase, increasing the efficiency of sumoylation.

AA Sequence

MEELSSVGEQVFAAECILSKRLRKGKLEYLVKWRGWSSKHNSWEPEENILDPRLLLAFQKKEHEKEVQNR      1 - 70
KRGKRPRGRPRKLTAMSSCSRRSKLKEPDAPSKSKSSSSSSSSTSSSSSSDEEDDSDLDAKRGPRGRETH     71 - 140
PVPQKKAQILVAKPELKDPIRKKRGRKPLPPEQKATRRPVSLAKVLKTARKDLGAPASKLPPPLSAPVAG    141 - 210
LAALKAHAKEACGGPSAMATPENLASLMKGMASSPGRGGISWQSSIVHYMNRMTQSQAQAASRLALKAQA    211 - 280
TNKCGLGLDLKVRTQKGELGMSPPGSKIPKAPSGGAVEQKVGNTGGPPHTHGASRVPAGCPGPQPAPTQE    281 - 350
LSLQVLDLQSVKNGMPGVGLLARHATATKGVPATNPAPGKGTGSGLIGASGATMPTDTSKSEKLASRAVA    351 - 420
PPTPASKRDCVKGSATPSGQESRTAPGEARKAATLPEMSAGEESSSSDSDPDSASPPSTGQNPSVSVQTS    421 - 490
QDWKPTRSLIEHVFVTDVTANLITVTVKESPTSVGFFNLRHY                                491 - 532
//

Text Mined References (29)

PMID Year Title
26877821 2016 Identification of the epigenetic reader CBX2 as a potential drug target in advanced prostate cancer.
26431491 2015 Long non-coding RNA profiling links subgroup classification of endometrioid endometrial carcinomas with trithorax and polycomb complex aberrations.
25569159 2015 Genome-wide identification of CBX2 targets: insights in the human sex development network.
25416956 2014 A proteome-scale map of the human interactome network.
25225902 2014 Genotranscriptomic meta-analysis of the Polycomb gene CBX2 in human cancers: initial evidence of an oncogenic role.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
23219007 2013 CBX2 gene analysis in patients with 46,XY and 46,XX gonadal disorders of sex development.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22419124 2012 A human Polycomb isoform lacking the Pc box does not participate to PRC1 complexes but forms protein assemblies and represses transcription.
22009739 2011 Corepressor protein CDYL functions as a molecular bridge between polycomb repressor complex 2 and repressive chromatin mark trimethylated histone lysine 27.
21282530 2011 Interaction proteomics analysis of polycomb proteins defines distinct PRC1 complexes in mammalian cells.
19636380 2009 Several distinct polycomb complexes regulate and co-localize on the INK4a tumor suppressor locus.
19361780 2009 Ovaries and female phenotype in a girl with 46,XY karyotype and mutations in the CBX2 gene.
19107218 2008 Human polycomb 2 protein is a SUMO E3 ligase and alleviates substrate-induced inhibition of cystathionine beta-synthase sumoylation.
19060904 2009 An empirical framework for binary interactome mapping.
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12167701 2002 The core of the polycomb repressive complex is compositionally and functionally conserved in flies and humans.
10369680 1999 RYBP, a new repressor protein that interacts with components of the mammalian Polycomb complex, and with the transcription factor YY1.
9641679 1998 Male-to-female sex reversal in M33 mutant mice.
7782071 1995 Assignment of a Polycomb-like chromobox gene (CBX2) to human chromosome 17q25.
3081265 1986 Spatial regulation of Antennapedia and bithorax gene expression by the Polycomb locus in Drosophila.
2903050 1988 Different transcripts of the Drosophila Abd-B gene correlate with distinct genetic sub-functions.
2477932 1989 Early detection and screening for prostatic cancer.
1898775 1991 The Polycomb protein shares a homologous domain with a heterochromatin-associated protein of Drosophila.
1352241 1992 The mouse has a Polycomb-like chromobox gene.