Property Summary

NCBI Gene PubMed Count 67
PubMed Score 197.03
PubTator Score 104.31

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (7)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.035 1.3e-02
group 3 medulloblastoma 1.700 3.9e-05
primary pancreatic ductal adenocarcinoma 1.134 1.8e-02
non-small cell lung cancer 1.094 5.8e-19
lung cancer 1.300 1.3e-04
ovarian cancer -1.600 2.8e-04
dermatomyositis 1.400 1.5e-04

MLP Assay (3)

AID Type Active / Inconclusive / Inactive Description
488953 confirmatory 186 / 277 / 817 qHTS Validation Assay for Inhibitors of HP1-beta Chromodomain Interactions with Methylated Histone Tails
488962 summary 0 / 0 / 0 Probe Summary Assay for Inhibitors of HP1-beta Chromodomain Interactions with Methylated Histone Tails
540317 confirmatory 2150 / 13416 / 371468 HTS for Inhibitors of HP1-beta Chromodomain Interactions with Methylated Histone Tails

Gene RIF (28)

PMID Text
27090491 Data show that heterochromatin protein 1-beta (HP1beta) is a prototypic HP1 protein exemplifying most basal chromatin binding and effects.
25769025 increased HP1beta expression is associated with the poor prognosis in breast cancer
24840329 Data suggest the reduction of Heterochromatin Protein 1 isoforms HP1beta followed by a decrease in HP1alpha contributes to the pathogenesis of thyroid carcinomas, and their loss is a potential marker of thyroid malignancy and metastatic potential, respectively.
24793759 In this review, we summarize the current knowledge about targeting and functional mechanisms of PRCs, emphasizing the recent breakthroughs related to CBX proteins under a number of physiological and pathological conditions.
24561199 Phosphorylation at Ser89 and Ser175 results in localized conformational changes in HP1beta that do not compromise the ability of the protein to bind chromatin.
23707759 The HP1beta interactome is enriched with Lys methylated proteins.Role of HP1beta in DNA damage response.
23585859 The structural plasticity of HP1beta supports its ability to bind and connect a wide variety of binding partners in epigenetic processes.
23536649 HP1 isoforms distinctly augment AR signaling and cell growth in prostate cancer. Therefore, silencing of HP1beta and HP1gamma may be a promising therapeutic strategy for treatment of prostate cancer.
23337132 HP1beta which is associated with PCNA in regions of DNA repair, is bound and does not exchange with the mobile pool, suggesting that HP1beta in association with PCNA may be a component of a DNA repair complex.
23287531 study finds that while HP1apha and beta stimulate homologous recombination and single-strand annealing, HP1gamma has an inhibitory role
22815475 Methylation of lysine 9 in histone H3 directs alternative modes of highly dynamic interaction of heterochromatin protein hHP1beta with the nucleosome
22715096 a novel mechanism of KAP-1-mediated chromatin restructuring via Chk2-regulated HP1-beta exchange from heterochromatin, promoting DNA repair.
22617335 HP1 beta and PCNA, a key player in DNA replication, are closely spaced components of a multiprotein complex involved in replication, both in S phase and during DNA repair, and that the functional complex requires formation of an HP1 dimer.
21281799 Abrogating GRP/GRPR signaling specifically down-regulates HP1(Hsbeta) expression and inhibiting GRPR signaling, or ablating HP1(Hsbeta) expression, increases colon cancer cell invasiveness in vitro.
20498703 Mislocalized lamins can induce ubiquitin-mediated proteasomal degradation of certain HP1 isoforms by activation of FBXW10, a member of the F-box family of proteins that is involved in E3 ubiquitin ligase activity.
20308360 HP1beta is involved in the proliferation of AR-expressing prostate cancer cells and progression to CRPC as an AR coactivator.
18599480 a nonconventional interaction between HP1 and a tissue-specific transcription factor, MyoD. In addition, they strongly suggest that HP1 isoforms play important roles during muscle terminal differentiation in an isoform-dependent manner.
18590578 when HP1beta was co-expressed with TIF1beta/S473A, but not TIF1beta/S473E, the colocalization of TIF1beta/S473A and HP1beta to the promoters of Cdc2 and Cdc25A was enhanced.
18438399 findings reveal an unrecognized signalling cascade that helps to initiate the DNA damage response, altering chromatin by modifying a histone-code mediator protein, HP1, but not the code itself
18239689 HP1 recruitment-release is a sequential mechanism that is precisely regulated and highly dependent on transcription.
17575412 Overexpression of HP1-BETA in eye imaginal discs caused abnormally patterned eyes, with reduced numbers of ommatidia.
16615912 HP1 binding as analyzed through the crystal structure of the HP1-EMSY complex
16547356 analysis of methylation-independent binding to histone H3 and cell cycle-dependent incorporation of HP1beta into heterochromatin
15899859 HP1beta recruits endogenous HP1alpha to the chromatin and this induces heterochromatin formation and enhanced histone lysine methylation.
14585993 cells are exquisitely sensitive to the amount of HP1(Hsalpha) or HP1(Hsbeta) present, as their overexpression influences telomere stability, population doubling time, radioresistance, and tumorigenicity
12560555 the chromodomain and the chromoshadow domain of HP1 are both required for binding to native chromatin in vivo, but they contribute differentially to binding in euchromatin and heterochromatin
12054505 Gene regulation by human orthologs of Drosophila heterochromatin protein 1.
11959914 Isoform-specific interaction of HP1 with human TAFII130.

AA Sequence

MGKKQNKKKVEEVLEEEEEEYVVEKVLDRRVVKGKVEYLLKWKGFSDEDNTWEPEENLDCPDLIAEFLQS      1 - 70
QKTAHETDKSEGGKRKADSDSEDKGEESKPKKKKEESEKPRGFARGLEPERIIGATDSSGELMFLMKWKN     71 - 140
SDEADLVPAKEANVKCPQVVISFYEERLTWHSYPSEDDDKKDDKN                             141 - 185
//

Text Mined References (76)

PMID Year Title
27090491 2016 Dynamic and flexible H3K9me3 bridging via HP1? dimerization establishes a plastic state of condensed chromatin.
25769025 2015 HP1? is a biomarker for breast cancer prognosis and PARP inhibitor therapy.
25755297 2015 System-wide Analysis of SUMOylation Dynamics in Response to Replication Stress Reveals Novel Small Ubiquitin-like Modified Target Proteins and Acceptor Lysines Relevant for Genome Stability.
24840329 2014 Heterochromatin protein 1 expression is reduced in human thyroid malignancy.
24793759 2014 Epigenetic regulation by polycomb group complexes: focus on roles of CBX proteins.
24561199 2014 Characterization of the effects of phosphorylation by CK2 on the structure and binding properties of human HP1?.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24270157 2013 A quantitative telomeric chromatin isolation protocol identifies different telomeric states.
23707759 2013 A method for systematic mapping of protein lysine methylation identifies functions for HP1? in DNA damage response.
23585859 2013 Structural plasticity in human heterochromatin protein 1?.
23536649 2013 Human heterochromatin protein 1 isoforms regulate androgen receptor signaling in prostate cancer.
23337132 Dynamics of the HP1?-PCNA-containing complexes in DNA replication and repair.
23287531 2013 Differential contribution of HP1 proteins to DNA end resection and homology-directed repair.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22949513 2012 Genome-wide association analysis of genetic generalized epilepsies implicates susceptibility loci at 1q43, 2p16.1, 2q22.3 and 17q21.32.
22815475 2012 Methylation of lysine 9 in histone H3 directs alternative modes of highly dynamic interaction of heterochromatin protein hHP1? with the nucleosome.
22715096 2012 Kruppel-associated Box (KRAB)-associated co-repressor (KAP-1) Ser-473 phosphorylation regulates heterochromatin protein 1? (HP1-?) mobilization and DNA repair in heterochromatin.
22617335 2012 A heterochromatin protein 1 (HP1) dimer and a proliferating cell nuclear antigen (PCNA) protein interact in vivo and are parts of a multiprotein complex involved in DNA replication and DNA repair.
21888893 2011 Analysis of the human HP1 interactome reveals novel binding partners.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21281799 2011 Gastrin-releasing peptide signaling alters colon cancer invasiveness via heterochromatin protein 1Hs?.
21269460 2011 Initial characterization of the human central proteome.
20935630 2010 Association analyses of 249,796 individuals reveal 18 new loci associated with body mass index.
20871592 2010 Methyl-H3K9-binding protein MPP8 mediates E-cadherin gene silencing and promotes tumour cell motility and invasion.
20850016 2010 Quantitative interaction proteomics and genome-wide profiling of epigenetic histone marks and their readers.
20562864 2010 Human POGZ modulates dissociation of HP1alpha from mitotic chromosome arms through Aurora B activation.
20498703 2010 Lamin A rod domain mutants target heterochromatin protein 1alpha and beta for proteasomal degradation by activation of F-box protein, FBXW10.
20308360 2010 Human heterochromatin protein 1 isoform HP1beta enhances androgen receptor activity and is implicated in prostate cancer growth.
20195357 2010 A comprehensive resource of interacting protein regions for refining human transcription factor networks.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19880879 2010 ASXL1 represses retinoic acid receptor-mediated transcription through associating with HP1 and LSD1.
19486527 2009 The histone methyltransferase SUV420H2 and Heterochromatin Proteins HP1 interact but show different dynamic behaviours.
19135898 2009 Purification of proteins associated with specific genomic Loci.
18599480 2008 Differential cooperation between heterochromatin protein HP1 isoforms and MyoD in myoblasts.
18590578 2008 Phosphorylation at Ser473 regulates heterochromatin protein 1 binding and corepressor function of TIF1beta/KAP1.
18438399 2008 HP1-beta mobilization promotes chromatin changes that initiate the DNA damage response.
18318008 2008 Large-scale phosphoproteome analysis of human liver tissue by enrichment and fractionation of phosphopeptides with strong anion exchange chromatography.
18239689 2008 Regulation of an inducible promoter by an HP1beta-HP1gamma switch.
17575412 2007 Functional domain analysis of human HP1 isoforms in Drosophila.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16615912 2006 Crystal structure of the HP1-EMSY complex reveals an unusual mode of HP1 binding.
16547356 2006 Methylation-independent binding to histone H3 and cell cycle-dependent incorporation of HP1beta into heterochromatin.
16415788 2006 Tudor, MBT and chromo domains gauge the degree of lysine methylation.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16169070 2005 A human protein-protein interaction network: a resource for annotating the proteome.
16127177 2005 HP1 binds specifically to Lys26-methylated histone H1.4, whereas simultaneous Ser27 phosphorylation blocks HP1 binding.
15947784 2005 Binding of EMSY to HP1beta: implications for recruitment of HP1beta and BS69.
15899859 2005 In vivo HP1 targeting causes large-scale chromatin condensation and enhanced histone lysine methylation.
15635413 2005 Nucleolar proteome dynamics.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14651845 2003 EMSY links the BRCA2 pathway to sporadic breast and ovarian cancer.
14585993 2003 Human heterochromatin protein 1 isoforms HP1(Hsalpha) and HP1(Hsbeta) interfere with hTERT-telomere interactions and correlate with changes in cell growth and response to ionizing radiation.
12867029 2003 Suv39h-mediated histone H3 lysine 9 methylation directs DNA methylation to major satellite repeats at pericentric heterochromatin.
12711675 2003 The DNA methyltransferases associate with HP1 and the SUV39H1 histone methyltransferase.
12560555 2003 Maintenance of stable heterochromatin domains by dynamic HP1 binding.
12560554 2003 Modulation of heterochromatin protein 1 dynamics in primary Mammalian cells.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12414990 2002 A developmentally regulated ARF-like 5 protein (ARL5), localized to nuclei and nucleoli, interacts with heterochromatin protein 1.
12054505 2002 Gene regulation by human orthologs of Drosophila heterochromatin protein 1.
11959914 2002 Isoform-specific interaction of HP1 with human TAFII130.
11882902 2002 Structure of the HP1 chromodomain bound to histone H3 methylated at lysine 9.
11790298 2002 Directed proteomic analysis of the human nucleolus.
11336697 2001 Heterochromatin formation in mammalian cells: interaction between histones and HP1 proteins.
11242054 2001 Selective recognition of methylated lysine 9 on histone H3 by the HP1 chromo domain.
11242053 2001 Methylation of histone H3 lysine 9 creates a binding site for HP1 proteins.
11101528 2000 Dynamic associations of heterochromatin protein 1 with the nuclear envelope.
10882726 2000 Heterochromatin protein 1 binds to nucleosomes and DNA in vitro.
10747027 2000 The structure of mouse HP1 suggests a unique mode of single peptide recognition by the shadow chromo domain dimer.
10562550 1999 Interaction with members of the heterochromatin protein 1 (HP1) family and histone deacetylation are differentially involved in transcriptional silencing by members of the TIF1 family.
10549285 1999 Heterochromatin dynamics in mouse cells: interaction between chromatin assembly factor 1 and HP1 proteins.
10460410 1999 Localization and phosphorylation of HP1 proteins during the cell cycle in mammalian cells.
10202156 1999 Functional mammalian homologues of the Drosophila PEV-modifier Su(var)3-9 encode centromere-associated proteins which complex with the heterochromatin component M31.
9636146 1998 Interaction of SP100 with HP1 proteins: a link between the promyelocytic leukemia-associated nuclear bodies and the chromatin compartment.
9454751 1998 Stage-specific expression of polycomb group genes in human bone marrow cells.
9169582 1997 Heterochromatin protein HP1Hsbeta (p25beta) and its localization with centromeres in mitosis.
8287692 1994 A mammalian homologue of Drosophila heterochromatin protein 1 (HP1) is a component of constitutive heterochromatin.