Property Summary

NCBI Gene PubMed Count 10
PubMed Score 41.37
PubTator Score 49.88

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
gastric cancer 1.300 9.7e-04
hepatocellular carcinoma 1.300 8.9e-06
astrocytic glioma 2.800 1.2e-03
ependymoma 2.400 4.3e-03
oligodendroglioma 2.900 1.4e-03
osteosarcoma -1.973 3.2e-05
sonic hedgehog group medulloblastoma 1.300 1.8e-03
primitive neuroectodermal tumor 1.500 1.3e-04
intraductal papillary-mucinous adenoma (... 1.600 1.5e-04
intraductal papillary-mucinous carcinoma... 1.500 2.2e-03
intraductal papillary-mucinous neoplasm ... 1.600 2.7e-02
lung carcinoma 1.100 2.7e-12
Pick disease 1.300 1.2e-05
progressive supranuclear palsy -1.100 5.1e-03
ovarian cancer -2.600 3.5e-14

Gene RIF (3)

PMID Text
20877624 Observational study of gene-disease association. (HuGE Navigator)
19571038 Hs17beta-HSD8 and HsCBR4 show a strong genetic interaction in vivo in yeast, where, only if they are expressed together, they rescue the respiratory deficiency and restore the lipoic acid content of oar1Delta cells.
19000905 CBR4 is a mitochondrial NADPH-dependent reductase for o- and p-quinones.

AA Sequence

MDKVCAVFGGSRGIGRAVAQLMARKGYRLAVIARNLEGAKAAAGDLGGDHLAFSCDVAKEHDVQNTFEEL      1 - 70
EKHLGRVNFLVNAAGINRDGLLVRTKTEDMVSQLHTNLLGSMLTCKAAMRTMIQQQGGSIVNVGSIVGLK     71 - 140
GNSGQSVYSASKGGLVGFSRALAKEVARKKIRVNVVAPGFVHTDMTKDLKEEHLKKNIPLGRFGETIEVA    141 - 210
HAVVFLLESPYITGHVLVVDGGLQLIL                                               211 - 237
//

Text Mined References (16)

PMID Year Title
25203508 2014 Insights into mitochondrial fatty acid synthesis from the structure of heterotetrameric 3-ketoacyl-ACP reductase/3R-hydroxyacyl-CoA dehydrogenase.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20837989 2010 Naturally occurring variants of human aldo-keto reductases with reduced in vitro metabolism of daunorubicin and doxorubicin.
19571038 2009 17beta-hydroxysteroid dehydrogenase type 8 and carbonyl reductase type 4 assemble as a ketoacyl reductase of human mitochondrial FAS.
19027726 2009 The SDR (short-chain dehydrogenase/reductase and related enzymes) nomenclature initiative.
19000905 2008 Human carbonyl reductase 4 is a mitochondrial NADPH-dependent quinone reductase.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.