Property Summary

NCBI Gene PubMed Count 38
PubMed Score 36.92
PubTator Score 46.11

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (10)

Disease log2 FC p
malignant mesothelioma -1.200 9.2e-06
esophageal adenocarcinoma -1.900 1.8e-02
medulloblastoma, large-cell -1.100 4.3e-03
lung cancer -1.500 1.1e-04
active Crohn's disease 2.044 1.1e-02
ulcerative colitis 2.000 2.0e-07
cystic fibrosis 1.300 2.1e-03
psoriasis 1.100 6.2e-11
Endometriosis -1.386 1.9e-02
ovarian cancer -1.300 1.2e-03

Synonym

Accession O75828 Q6FHP2
Symbols hCBR3
SDR21C2
HEL-S-25

Gene

PANTHER Protein Class (2)

PDB

2HRB  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Protein-protein Interaction (2)

Gene RIF (29)

PMID Text
26799497 association of SNPs in ABCB1 and CBR3 with chronic cardiotoxicity in a cohort of breast cancer patients treated with anthracyclines.
26563179 No significant correlation between cardiotoxicity and SNPs within the CBR pathway. Further investigation into CBR SNPs in a larger adult sample is needed.
23182048 Variants of CBR3 and GSTP1 enzymes may be associated with changes in short-term functional cardiac parameters.
22527884 genetic polymorphism in the CBR3 gene conferred risk of type 2 diabetes and insulin resistance in Chinese. The association was probably mediated through modulation of adipogenesis.
22425771 CBR3 is a novel target gene of inflammatory stimuli; elucidation of its detailed role in inflammation deserves further investigation.
22360420 A protein encoded by this locus was found to be differentially expressed in postmortem brains from patients with atypical frontotemporal lobar degeneration.
22124095 CBR3 polymorphisms contribute to increased cardiomyopathy risk associated with anthracycline treatment of childhood cancer.
22001310 Computational searches identify a conserved antioxidant response element(ARE) in the distal carbonyl reductase 3 (CBR3) promoter region.
21256830 a physiological role of CBR1, but not for CBR3, in S-nitrosoglutathione reduction and thus ultimately in regulation of NO signaling
20806931 CBR3 is regulated via NRF2-dependent signaling pathways, a finding and plays an important role in the cellular response to oxidative stress.
20734064 Observational study of gene-disease association. (HuGE Navigator)
20494980 The CBR3 distal promoter contains an activating cis-regulatory element that is responsive to Trichostatin A (TSA) treatment according to promoter reporter assays in HEK 293 cells.
19841672 analysis of the structural basis for substrate specificity in human monomeric carbonyl reductases CBR3
19692168 Observational study of gene-disease association. (HuGE Navigator)
19671875 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19625176 Observational study of gene-disease association. (HuGE Navigator)
19590938 identified the promoter of human CBR3. Liver samples from black donors showed higher relative CBR3 mRNA levels than samples from whites
19170196 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19016765 CBR3 polymorphisms have no significant influence on the pharmacokinetics of doxorubicin in Asian breast cancer patients.
19016765 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18676680 Observational study of gene-disease association. (HuGE Navigator)
18551042 Polymorphisms in CBR3 may explain interindividual and interethnic variability of doxorubicin pharmacokinetics and pharmacodynamics.
18551042 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18493841 These results suggested that hCBR3 and hCBR1 play distinct physiological roles.
18457324 There was a trend toward an association between the CBR3 V244M polymorphism and the risk of CHf
18457324 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
15537833 The common carbonyl reductase 3 (CBR3)valine244methionine polymorphism encodes for CBR3 isoforms with distinctive enzymatic properties, as revealed in DNA variation panels from 10 ethnic groups.
11592776 Decreased Carbonyl Reductase expression in epithelial ovarian cancer is associated with RLN metastasis and poor survival
10728668 carbonyl reductase has an important function in modifying the metastatic behavior of malignant tumors.

AA Sequence

MSSCSRVALVTGANRGIGLAIARELCRQFSGDVVLTARDVARGQAAVQQLQAEGLSPRFHQLDIDDLQSI      1 - 70
RALRDFLRKEYGGLNVLVNNAAVAFKSDDPMPFDIKAEMTLKTNFFATRNMCNELLPIMKPHGRVVNISS     71 - 140
LQCLRAFENCSEDLQERFHSETLTEGDLVDLMKKFVEDTKNEVHEREGWPNSPYGVSKLGVTVLSRILAR    141 - 210
RLDEKRKADRILVNACCPGPVKTDMDGKDSIRTVEEGAETPVYLALLPPDATEPQGQLVHDKVVQNW       211 - 277
//

Text Mined References (39)

PMID Year Title
26799497 2016 Evidence for association of SNPs in ABCB1 and CBR3, but not RAC2, NCF4, SLC28A3 or TOP2B, with chronic cardiotoxicity in a cohort of breast cancer patients treated with anthracyclines.
26563179 2016 Risk factors for anthracycline-associated cardiotoxicity.
23227193 2012 Analysis of copy number variation in Alzheimer's disease in a cohort of clinically characterized and neuropathologically verified individuals.
23182048 2012 The relationship between changes in functional cardiac parameters following anthracycline therapy and carbonyl reductase 3 and glutathione S transferase Pi polymorphisms.
22664934 2012 Comparison of tear protein levels in breast cancer patients and healthy controls using a de novo proteomic approach.
22527884 2012 Genetic variation in the carbonyl reductase 3 gene confers risk of type 2 diabetes and insulin resistance: a potential regulator of adipogenesis.
22504420 2012 Genome-wide meta-analysis identifies 56 bone mineral density loci and reveals 14 loci associated with risk of fracture.
22425771 2012 Expression of human carbonyl reductase 3 (CBR3; SDR21C2) is inducible by pro-inflammatory stimuli.
22360420 2012 Proteomic analysis identifies dysfunction in cellular transport, energy, and protein metabolism in different brain regions of atypical frontotemporal lobar degeneration.
22124095 2012 Anthracycline-related cardiomyopathy after childhood cancer: role of polymorphisms in carbonyl reductase genes--a report from the Children's Oncology Group.
22001310 2012 A conserved antioxidant response element (ARE) in the promoter of human carbonyl reductase 3 (CBR3) mediates induction by the master redox switch Nrf2.
21269460 2011 Initial characterization of the human central proteome.
21256830 2011 Studies on reduction of S-nitrosoglutathione by human carbonyl reductases 1 and 3.
20806931 2010 Regulation of human carbonyl reductase 3 (CBR3; SDR21C2) expression by Nrf2 in cultured cancer cells.
20734064 2010 A large-scale candidate gene association study of age at menarche and age at natural menopause.
20494980 2010 Functional analysis and identification of cis-regulatory elements of human chromosome 21 gene promoters.
19841672 2009 Structural basis for substrate specificity in human monomeric carbonyl reductases.
19692168 2010 Genetic susceptibility to distinct bladder cancer subphenotypes.
19671875 2009 Nitric oxide synthase variants and disease-free survival among treated and untreated breast cancer patients in a Southwest Oncology Group clinical trial.
19625176 2009 PTEN identified as important risk factor of chronic obstructive pulmonary disease.
19590938 2009 Identification of the promoter of human carbonyl reductase 3 (CBR3) and impact of common promoter polymorphisms on hepatic CBR3 mRNA expression.
19170196 2009 Polymorphisms in innate immunity genes and lung cancer risk in Xuanwei, China.
19027726 2009 The SDR (short-chain dehydrogenase/reductase and related enzymes) nomenclature initiative.
19016765 2008 CBR1 and CBR3 pharmacogenetics and their influence on doxorubicin disposition in Asian breast cancer patients.
18676680 2008 Pathway-based evaluation of 380 candidate genes and lung cancer susceptibility suggests the importance of the cell cycle pathway.
18551042 2008 Genotype of human carbonyl reductase CBR3 correlates with doxorubicin disposition and toxicity.
18493841 2008 Different functions between human monomeric carbonyl reductase 3 and carbonyl reductase 1.
18457324 2008 Genetic polymorphisms in the carbonyl reductase 3 gene CBR3 and the NAD(P)H:quinone oxidoreductase 1 gene NQO1 in patients who developed anthracycline-related congestive heart failure after childhood cancer.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
15537833 2005 Functional significance of a natural allelic variant of human carbonyl reductase 3 (CBR3).
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11592776 2001 Carbonyl reductase as a significant predictor of survival and lymph node metastasis in epithelial ovarian cancer.
10830953 2000 The DNA sequence of human chromosome 21.
10728668 2000 Carbonyl reductase: a novel metastasis-modulating function.
9740676 1998 Mapping of a novel human carbonyl reductase, CBR3, and ribosomal pseudogenes to human chromosome 21q22.2.
9503011 1998 Transcriptional map of the 2.5-Mb CBR-ERG region of chromosome 21 involved in Down syndrome.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
7705364 1995 Cloning and expression of carbonyl reductase from rat testis.