Property Summary

NCBI Gene PubMed Count 63
PubMed Score 96.21
PubTator Score 271.34

Knowledge Summary

Patent

No data available

Expression

Gene RIF (33)

PMID Text
26499922 These results suggest that CR1 induces apoptosis by activating the caspase pathway via binding to TNFR1.
26381805 Critical insights into the substrate selectivity of hCBR1 and the interaction between hCBR1 and glutathione.
26328486 Up-Regulation of Carbonyl Reductase 1 Renders Development of Doxorubicin Resistance in Human Gastrointestinal Cancers
26282591 Results demonstrate a trend toward decreased functional expression of selective hepatic reductases in ESRD livers.
25572536 CBR1 decreases promoted tumor proliferation and growth as well as invasion and metastasis; CBR1 has potential to become a new candidate for molecular targeting therapy.
25541467 Inhibition of CBR1 may increase the efficacy of daunorubicin in cancer tissue.
25526449 Protein products of AKR1C1, AKR1C2, AKR7A3, CYP3A4, and carbonyl reductase (CBR1) were found in tumors and those of AKR1C1, AKR7A3, and CBR1 correlated with their transcript levels.
24654784 The stimulatory effect of cortisol on CBR1 expression may partly explain the concurrent increases of cortisol and prostaglandin PGF2alpha in human amnion tissue prior to the onset of labor
24440593 we suggest that PEP-1-CBR1 protein may be a therapeutic agent for the treatment of ischemic injuries as well as oxidative-stress-induced cell damage and death.
23295225 GSNO-induced covalent modification of cysteine residues affects the kinetic mechanism of CBR1.
23247010 Nrf2 is a novel transcriptional regulator of CBR1 genes in humans.
23133646 regulation of human CBR1 expression by hsa-miR-574-5p and hsa-miR-921 depends upon rs9024 genotype status
22562609 This pilot study suggests that CBR1 RNA expression may be helpful in identifying AML patients at risk of developing resistance or toxicity to daunorubicin due to increased formation of daunorubicinol.
22542806 CBR1 regulates cancer cell invasion in endometrial adenocarcinomas by regulating the epithelial mesenchymal transition
22360420 A protein encoded by this locus was found to be differentially expressed in postmortem brains from patients with atypical frontotemporal lobar degeneration.
22124095 Polymorphisms in CBR1 gene did not increase risk of cardiomyopathy after anthracycline treatment of childhood cancers.
21256830 a physiological role of CBR1, but not for CBR3, in S-nitrosoglutathione reduction and thus ultimately in regulation of NO signaling
20471030 This protein has been found differentially expressed in thalami from patients with schizophrenia.
19841672 analysis of the structural basis for substrate specificity in human monomeric carbonyl reductases CBR1
19692168 Observational study of gene-disease association. (HuGE Navigator)
19625176 Observational study of gene-disease association. (HuGE Navigator)
19204081 the nonsynonymous single nucleotide polymorphisms generating mutations OF CBR1 may alter bioavailability of anthracyclines in cancer patients
19170196 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19022938 Observational study of gene-disease association. (HuGE Navigator)
19016765 CBR1 polymorphisms have a significant influence on the pharmacokinetics of doxorubicin in Asian breast cancer patients.
19016765 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18826943 Human carbonyl reductase 1 is an S-nitrosoglutathione reductase
18676680 Observational study of gene-disease association. (HuGE Navigator)
18551042 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18493841 These results suggested that hCBR3 and hCBR1 play distinct physiological roles.
17697149 Carbonyl reductase-1 (CBR1), microsomal prostaglandin E synthase-1 and 2 (mPGES-1, mPGES-2), cytosolic prostaglandin E synthase (cPGES), aldoketoreductase (AKR1C1) and prostaglandin F synthase (AKR1C3) were all expressed in hair follicles.
17569794 The functional characterization of the promoter of CBR1 is reported.
17344335 the functional genetic determinant of CBR1 activity toward relevant physiological and pharmacological substrates

AA Sequence

MSSGIHVALVTGGNKGIGLAIVRDLCRLFSGDVVLTARDVTRGQAAVQQLQAEGLSPRFHQLDIDDLQSI      1 - 70
RALRDFLRKEYGGLDVLVNNAGIAFKVADPTPFHIQAEVTMKTNFFGTRDVCTELLPLIKPQGRVVNVSS     71 - 140
IMSVRALKSCSPELQQKFRSETITEEELVGLMNKFVEDTKKGVHQKEGWPSSAYGVTKIGVTVLSRIHAR    141 - 210
KLSEQRKGDKILLNACCPGWVRTDMAGPKATKSPEEGAETPVYLALLPPDAEGPHGQFVSEKRVEQW       211 - 277
//

Text Mined References (68)

PMID Year Title
26499922 2015 Inhibitory effect of carbonyl reductase 1 on ovarian cancer growth via tumor necrosis factor receptor signaling.
26381805 2015 Structural insights on the catalytic site protection of human carbonyl reductase 1 by glutathione.
26328486 2015 Up-Regulation of Carbonyl Reductase 1 Renders Development of Doxorubicin Resistance in Human Gastrointestinal Cancers.
26282591 2015 Downregulation of Hepatic Carbonyl Reductase Type 1 in End-Stage Renal Disease.
25572536 2015 Decreased expression of carbonyl reductase 1 promotes ovarian cancer growth and proliferation.
25541467 2015 Curcumin is a tight-binding inhibitor of the most efficient human daunorubicin reductase--Carbonyl reductase 1.
25526449 2014 The role of cytochromes p450 and aldo-keto reductases in prognosis of breast carcinoma patients.
24769233 2014 Proteomic analysis of cerebrospinal fluid extracellular vesicles: a comprehensive dataset.
24654784 2014 Induction of PGF2? synthesis by cortisol through GR dependent induction of CBR1 in human amnion fibroblasts.
24440593 2014 Neuroprotective effects of PEP-1-carbonyl reductase 1 against oxidative-stress-induced ischemic neuronal cell damage.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23295225 2013 S-nitrosoglutathione covalently modifies cysteine residues of human carbonyl reductase 1 and affects its activity.
23247010 2013 Regulation of human carbonyl reductase 1 (CBR1, SDR21C1) gene by transcription factor Nrf2.
23133646 2012 MicroRNAs differentially regulate carbonyl reductase 1 (CBR1) gene expression dependent on the allele status of the common polymorphic variant rs9024.
22562609 2012 Carbonyl reductase 1 expression influences daunorubicin metabolism in acute myeloid leukemia.
22542806 2012 Decreased carbonyl reductase 1 expression promotes malignant behaviours by induction of epithelial mesenchymal transition and its clinical significance.
22360420 2012 Proteomic analysis identifies dysfunction in cellular transport, energy, and protein metabolism in different brain regions of atypical frontotemporal lobar degeneration.
22124095 2012 Anthracycline-related cardiomyopathy after childhood cancer: role of polymorphisms in carbonyl reductase genes--a report from the Children's Oncology Group.
21492153 2011 Analysis of proteomic changes induced upon cellular differentiation of the human intestinal cell line Caco-2.
21269460 2011 Initial characterization of the human central proteome.
21256830 2011 Studies on reduction of S-nitrosoglutathione by human carbonyl reductases 1 and 3.
20562859 2010 Network organization of the human autophagy system.
20471030 2010 Proteome analysis of the thalamus and cerebrospinal fluid reveals glycolysis dysfunction and potential biomarkers candidates for schizophrenia.
19841672 2009 Structural basis for substrate specificity in human monomeric carbonyl reductases.
19692168 2010 Genetic susceptibility to distinct bladder cancer subphenotypes.
19625176 2009 PTEN identified as important risk factor of chronic obstructive pulmonary disease.
19442656 2009 Involvement of an aldo-keto reductase (AKR1C3) in redox cycling of 9,10-phenanthrenequinone leading to apoptosis in human endothelial cells.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19204081 2009 Two nonsynonymous single nucleotide polymorphisms of human carbonyl reductase 1 demonstrate reduced in vitro metabolism of daunorubicin and doxorubicin.
19199708 2009 Proteomic analysis of human parotid gland exosomes by multidimensional protein identification technology (MudPIT).
19170196 2009 Polymorphisms in innate immunity genes and lung cancer risk in Xuanwei, China.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
19027726 2009 The SDR (short-chain dehydrogenase/reductase and related enzymes) nomenclature initiative.
19022938 2009 Pharmacogenetics of human carbonyl reductase 1 (CBR1) in livers from black and white donors.
19016765 2008 CBR1 and CBR3 pharmacogenetics and their influence on doxorubicin disposition in Asian breast cancer patients.
18826943 2008 Human carbonyl reductase 1 is an S-nitrosoglutathione reductase.
18676680 2008 Pathway-based evaluation of 380 candidate genes and lung cancer susceptibility suggests the importance of the cell cycle pathway.
18551042 2008 Genotype of human carbonyl reductase CBR3 correlates with doxorubicin disposition and toxicity.
18493841 2008 Different functions between human monomeric carbonyl reductase 3 and carbonyl reductase 1.
18449627 2008 Inhibition of polymorphic human carbonyl reductase 1 (CBR1) by the cardioprotectant flavonoid 7-monohydroxyethyl rutoside (monoHER).
17912391 2007 Glutathione traps formaldehyde by formation of a bicyclo[4.4.1]undecane adduct.
17697149 2007 Prostaglandin metabolism in human hair follicle.
17569794 2007 Functional characterization of the promoter of human carbonyl reductase 1 (CBR1). Role of XRE elements in mediating the induction of CBR1 by ligands of the aryl hydrocarbon receptor.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17344335 2007 A functional genetic polymorphism on human carbonyl reductase 1 (CBR1 V88I) impacts on catalytic activity and NADPH binding affinity.
15799708 2005 An unbiased cell morphology-based screen for new, biologically active small molecules.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12836057 2003 Protein levels of genes encoded on chromosome 21 in fetal Down syndrome brain: Challenging the gene dosage effect hypothesis (Part IV).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12123751 2002 Carbonyl reduction of the potential cytostatic drugs benfluron and 3,9-dimethoxybenfluron in human in vitro.
11771743 2001 Increased brain protein levels of carbonyl reductase and alcohol dehydrogenase in Down syndrome and Alzheimer's disease.
11306092 2001 Expression and NNK reducing activities of carbonyl reductase and 11beta-hydroxysteroid dehydrogenase type 1 in human lung.
10830953 2000 The DNA sequence of human chromosome 21.
10091578 1999 Identification of the reactive cysteine residue (Cys227) in human carbonyl reductase.
9740676 1998 Mapping of a novel human carbonyl reductase, CBR3, and ribosomal pseudogenes to human chromosome 21q22.2.
8432528 1993 Human carbonyl reductase (CBR) localized to band 21q22.1 by high-resolution fluorescence in situ hybridization displays gene dosage effects in trisomy 21 cells.
8421682 1993 Carboxyethyllysine in a protein: native carbonyl reductase/NADP(+)-dependent prostaglandin dehydrogenase.
7705364 1995 Cloning and expression of carbonyl reductase from rat testis.
7005231 1981 Purification and properties of an NADPH-dependent carbonyl reductase from human brain. Relationship to prostaglandin 9-ketoreductase and xenobiotic ketone reductase.
3311025 1987 Kinetics of carbonyl reductase from human brain.
3141401 1988 Human carbonyl reductase. Nucleotide sequence analysis of a cDNA and amino acid sequence of the encoded protein.
3083821 1986 Carbonyl reductase provides the enzymatic basis of quinone detoxication in man.
2182121 1990 Induction of a human carbonyl reductase gene located on chromosome 21.
1921984 1991 Genomic sequence and expression of a cloned human carbonyl reductase gene with daunorubicin reductase activity.
1540623 1992 Carbonyl reductase from human testis: purification and comparison with carbonyl reductase from human brain and rat testis.
1453004 1992 Immunohistochemical localization of carbonyl reductase in human tissues.