Property Summary

NCBI Gene PubMed Count 14
PubMed Score 3.68
PubTator Score 3.21

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
astrocytoma -3.300 1.3e-25
posterior fossa group B ependymoma -2.900 4.2e-09
oligodendroglioma -3.500 1.0e-22
glioblastoma multiforme -3.200 3.9e-25
medulloblastoma -2.300 1.7e-02
atypical teratoid / rhabdoid tumor -3.200 4.6e-07
medulloblastoma, large-cell -3.400 1.8e-03
adrenocortical adenoma -1.330 1.3e-03
adrenocortical carcinoma -2.166 3.3e-13
adult high grade glioma -1.400 2.5e-02
pilocytic astrocytoma -2.000 1.2e-02
Pick disease -1.200 7.6e-03
ovarian cancer -1.700 1.4e-07
psoriasis -1.500 4.5e-07

AA Sequence

MGSGRRALSAVPAVLLVLTLPGLPVWAQNDTEPIVLEGKCLVVCDSNPATDSKGSSSSPLGISVRAANSK      1 - 70
VAFSAVRSTNHEPSEMSNKTRIIYFDQILVNVGNFFTLESVFVAPRKGIYSFSFHVIKVYQSQTIQVNLM     71 - 140
LNGKPVISAFAGDKDVTREAATNGVLLYLDKEDKVYLKLEKGNLVGGWQYSTFSGFLVFPL             141 - 201
//

Text Mined References (15)

PMID Year Title
22220752 2012 The Cbln family of proteins interact with multiple signaling pathways.
22191730 2012 Glutamate receptor ?1 induces preferentially inhibitory presynaptic differentiation of cortical neurons by interacting with neurexins through cerebellin precursor protein subtypes.
21410790 2011 Cbln family proteins promote synapse formation by regulating distinct neurexin signaling pathways in various brain regions.
21356198 2011 Differential interactions of cerebellin precursor protein (Cbln) subtypes and neurexin variants for synapse formation of cortical neurons.
19212655 2009 Precerebellin-related genes and precerebellin 1 peptide in the adrenal gland of the rat: expression pattern, localization, developmental regulation and effects on corticosteroidogenesis.
18278437 2008 Cbln and C1q family proteins: new transneuronal cytokines.
17331201 2007 Characterization of a transneuronal cytokine family Cbln--regulation of secretion by heteromeric assembly.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15340161 2004 Signal peptide prediction based on analysis of experimentally verified cleavage sites.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11780052 2001 The DNA sequence and comparative analysis of human chromosome 20.