Property Summary

NCBI Gene PubMed Count 25
PubMed Score 2.63
PubTator Score 88.76

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (5)

Disease log2 FC p
interstitial cystitis -1.500 3.6e-03
lung adenocarcinoma 1.100 6.3e-05
non-small cell lung cancer 1.896 1.8e-19
pancreatic cancer 1.300 2.5e-04
ulcerative colitis -1.300 1.0e-03

Gene RIF (11)

AA Sequence

MALAVAPWGRQWEEARALGRAVRMLQRLEEQCVDPRLSVSPPSLRDLLPRTAQLLREVAHSRRAAGGGGP      1 - 70
GGPGGSGDFLLIYLANLEAKSRQVAALLPPRGRRSANDELFRAGSRLRRQLAKLAIIFSHMHAELHALFP     71 - 140
GGKYCGHMYQLTKAPAHTFWRESCGARCVLPWAEFESLLGTCHPVEPGCTALALRTTIDLTCSGHVSIFE    141 - 210
FDVFTRLFQPWPTLLKNWQLLAVNHPGYMAFLTYDEVQERLQACRDKPGSYIFRPSCTRLGQWAIGYVSS    211 - 280
DGSILQTIPANKPLSQVLLEGQKDGFYLYPDGKTHNPDLTELGQAEPQQRIHVSEEQLQLYWAMDSTFEL    281 - 350
CKICAESNKDVKIEPCGHLLCSCCLAAWQHSDSQTCPFCRCEIKGWEAVSIYQFHGQATAEDSGNSSDQE    351 - 420
GRELELGQVPLSAPPLPPRPDLPPRKPRNAQPKVRLLKGNSPPAALGPQDPAPA                    421 - 474
//

Text Mined References (28)

PMID Year Title