Property Summary

NCBI Gene PubMed Count 93
PubMed Score 6.58
PubTator Score 113.68

Knowledge Summary

Patent

No data available

Expression

 GWAS Trait (1)

Gene RIF (51)

PMID Text
26874193 direct interaction between Cblin and the TKB domain of Cbl-b
26353930 H19 non coding RNA-derived miR-675 enhances tumorigenesis and metastasis of breast cancer cells by downregulating c-Cbl and Cbl-b.
26112603 results show that Cbl-b suppresses human ORMDL3 expression through STAT6
26087197 Results suggest that Cbl-b improves the prognosis of RANK-expressing breast cancer patients by inhibiting RANKL-induced breast cancer cell migration and metastasis.
25921289 findings suggest that Cbl-b limits NGF-TrkA signaling to control the length of neurites.
25788263 Translocation of Cbl-b from the nucleus to the cytoplasm prevented the localization of P-gp to caveolae resulting in the reversal of multidrug resistance through the ubiquitination and degradation of c-Src.
25701378 Our results suggest that celecoxib-mediated upregulation of Cbl-b is responsible, at least in part, for the additive antitumor effect of celecoxib and rapamycin via inhibition of rapamycin-induced Akt activation.
25691332 Low CBLB expression is associated with glioma cell invasion.
25261476 The data suggest a role of the CBLB rs12487066 variant in the interactions of a genetic risk factor and IFN function during viral infections in multiple sclerosis.
24885194 Ubiquitin ligase Cbl-b represses IGF-I-induced epithelial mesenchymal transition via ZEB2 and microRNA-200c regulation in gastric cancer cells.
24351824 Cbl-b knockdown caused significant increase of phosphorylation of EGFR, ERK and Akt, decrease of mitochondrial membrane potential, and increase of expression ratio of Bcl-2/Bax.
24162774 HIV-1 gp120 downregulates the expression of Cbl proto-oncogene B, E3 ubiquitin protein ligase (CBLB) in human B cells
23665906 By up-regulating the expression of c-Cbl and Cbl-b, which leads to inhibition of PI3K/Akt signaling and down-regulation of P-gp expression, beta-elemene is capable of enhancing the efficacy of doxorubicin in leukemia and gastric cancer cells.
23586056 that icotinib-induced upregulation of Cbl-b is responsible, at least in part, for the antitumor effect of icotinib via the inhibition of phosphoinositide 3-kinase (PI3K)/Akt and mitogen-activated protein kinase pathways in EGFR-mutated NSCLC cells.
23280105 abnormal peripheral tolerance in SLE is caused by a deficiency in Cbl-b, and that this ubiquitin ligase plays a key role in regulating T-cell receptor signaling during the induction of peripheral tolerance.
23039885 FOXP3 mRNA expression correlated with CBLB and ITCH in MS patients.
22447040 Data show that bufalin-induced down-regulation of Cbl-b contributed to the up-regulation of TRAIL Receptors DR4 and DR5.
22194214 Pooled analysis corroborated the effect on multiple sclerosis predisposition of three genes: TMEM39A, IL12B, and CBLB
22158902 Autoinhibition and phosphorylation-induced activation mechanisms of human cancer and autoimmune disease-related E3 protein Cbl-b
21807564 Over expression of TGF-beta and CTLA-4 leads to T cell hyporesponsiveness, a major hallmark of leprosy, by increasing the expression of Cbl-b.
21768087 c-Cbl as well as Cbl-b may play important roles in Hsp90 inhibitor-induced degradation of Flt3-ITD through the ubiquitin proteasome system
21645455 the expression and clinical relevance of c-Cbl, Cbl-b and EGFR in non-small cell lung cancer
21558139 data suggest that Cbl-b may contribute to the deregulated activation of T lymphocytes observed in systemic lupus erythematosus (SLE); a significant association between the 2126(A/G) SNP and SLE was detected
21453975 Deregulations of Lck-ZAP-70-Cbl-b cross-talk and miR181a in T cells were found to be associated with cholesterol-dependent-dismantling of HLA-DR rafts in macrophages in leprosy progression.
21346257 CBLB mutation is asssociated with chronic myelogenous leukemia.
21248249 Interplay between transgenic Cblb-dependent T cell anergy and other mechanisms prevents organ-specific islet-cell autoimmunity.
21037273 These data provide further evidence of the association of MS disease with variation within CBLB.
21037273 Observational study of gene-disease association. (HuGE Navigator)
20453840 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20400514 Cbl-b plays a positive modulatory role in GPVI-dependent platelet signaling, which translates to an important regulatory role in hemostasis and thrombosis in vivo
20395198 Cbl-b and itch are key regulators of peripheral T-cell tolerance [review]
20237496 Observational study of gene-disease association. (HuGE Navigator)
20038312 Overexpressions of c-Cbl, Cbl-b, and EGFR are closely related to the invasion and progression of gastric carcinoma.
19834503 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
19546888 Cbls suppress cell death in healthy neurons at least in part by inhibiting the ability of mixed lineage kinases to activate JNK signaling.
19506219 Observational study of gene-disease association. (HuGE Navigator)
18316398 two Cbls accounted for total receptor ubiquitination and that while c-Cbl and Cbl-b are each alone sufficient to effect EGFR degradation, both are involved in the physiological, EGF-mediated process of receptor downregulation.
18201552 F328L mutation is involved in the development of autoimmune diseases including type 1 diabetes, and also provide insight into the structure-function relationship of CBLB protein
17475912 novel mutations in c-CBL and CBL-b have been identified in human acute myeloid leukemia
17235393 the host ubiquitin ligase Cbl-b interacts with the type III-secreted effector exotoxin T (ExoT) and plays a key role in vivo in limiting bacterial dissemination mediated by ExoT
17209142 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17209142 In a primary analysis, no evidence for an association of the CBLB SNP rs3772534 with disease was found in either sample set in type 1 diabetes.
16868939 results suggest that Cbl-b- or atrogin-1-mediated ubiquitination plays an important role in unloading-induced muscle atrophy, and that unloading stress may preferentially inhibit transcriptional responses in skeletal muscle
16459459 Observational study of gene-disease association. (HuGE Navigator)
15922296 NF-kappaB activity is enhanced by a PI3K signal mediated by Cbl-b and Rho
15629882 genetic interaction between the CTLA4 and CBLB genes in type 1 diabetes
15273720 Differences in ubiquitin-binding may reflect distinct regulatory functions of c-Cbl and Cbl-b.
14604964 Cbl-b is a negative regulator of both Lyn-Syk-LAT and Gab2mediated complementary signaling pathways in FcepsilonRI-mediated mast cell activation
12935897 Expression of Cbl-b effectively blocks the ability of Cool-2 to stimulate PAK, providing an additional mechanism, aside from catalyzing receptor ubiquitination, by which Cbl-b acts as a negative regulator for signaling activities requiring PAK activation.
12697763 Cbl-b plays a negative role in Crk-L-C3G-mediated Rap1 and LFA-1 activation in T cells.
11826757 novel E3 ubiquitin-protein ligase; role in regulation of immune response - review

AA Sequence

MANSMNGRNPGGRGGNPRKGRILGIIDAIQDAVGPPKQAAADRRTVEKTWKLMDKVVRLCQNPKLQLKNS      1 - 70
PPYILDILPDTYQHLRLILSKYDDNQKLAQLSENEYFKIYIDSLMKKSKRAIRLFKEGKERMYEEQSQDR     71 - 140
RNLTKLSLIFSHMLAEIKAIFPNGQFQGDNFRITKADAAEFWRKFFGDKTIVPWKVFRQCLHEVHQISSG    141 - 210
LEAMALKSTIDLTCNDYISVFEFDIFTRLFQPWGSILRNWNFLAVTHPGYMAFLTYDEVKARLQKYSTKP    211 - 280
GSYIFRLSCTRLGQWAIGYVTGDGNILQTIPHNKPLFQALIDGSREGFYLYPDGRSYNPDLTGLCEPTPH    281 - 350
DHIKVTQEQYELYCEMGSTFQLCKICAENDKDVKIEPCGHLMCTSCLTAWQESDGQGCPFCRCEIKGTEP    351 - 420
IIVDPFDPRDEGSRCCSIIDPFGMPMLDLDDDDDREESLMMNRLANVRKCTDRQNSPVTSPGSSPLAQRR    421 - 490
KPQPDPLQIPHLSLPPVPPRLDLIQKGIVRSPCGSPTGSPKSSPCMVRKQDKPLPAPPPPLRDPPPPPPE    491 - 560
RPPPIPPDNRLSRHIHHVESVPSRDPPMPLEAWCPRDVFGTNQLVGCRLLGEGSPKPGITASSNVNGRHS    561 - 630
RVGSDPVLMRKHRRHDLPLEGAKVFSNGHLGSEEYDVPPRLSPPPPVTTLLPSIKCTGPLANSLSEKTRD    631 - 700
PVEEDDDEYKIPSSHPVSLNSQPSHCHNVKPPVRSCDNGHCMLNGTHGPSSEKKSNIPDLSIYLKGDVFD    701 - 770
SASDPVPLPPARPPTRDNPKHGSSLNRTPSDYDLLIPPLGEDAFDALPPSLPPPPPPARHSLIEHSKPPG    771 - 840
SSSRPSSGQDLFLLPSDPFVDLASGQVPLPPARRLPGENVKTNRTSQDYDQLPSCSDGSQAPARPPKPRP    841 - 910
RRTAPEIHHRKPHGPEAALENVDAKIAKLMGEGYAFEEVKRALEIAQNNVEVARSILREFAFPPPVSPRL    911 - 980
NL                                                                        981 - 982
//

Text Mined References (101)

PMID Year Title
27107012 2016 Pooled-matrix protein interaction screens using Barcode Fusion Genetics.
26874193 2016 Structural analysis of the TKB domain of ubiquitin ligase Cbl-b complexed with its small inhibitory peptide, Cblin.
26353930 2015 H19 non coding RNA-derived miR-675 enhances tumorigenesis and metastasis of breast cancer cells by downregulating c-Cbl and Cbl-b.
26112603 2015 E3 ubiquitin ligase Cbl-b suppresses human ORMDL3 expression through STAT6 mediation.
26087197 2015 The E3 ubiquitin ligase Cbl-b improves the prognosis of RANK positive breast cancer patients by inhibiting RANKL-induced cell migration and metastasis.
25921289 2015 Temporal proteomics of NGF-TrkA signaling identifies an inhibitory role for the E3 ligase Cbl-b in neuroblastoma cell differentiation.
25814554 2015 Phospho-tyrosine dependent protein-protein interaction network.
25788263 2015 Cbl-b inhibits P-gp transporter function by preventing its translocation into caveolae in multiple drug-resistant gastric and breast cancers.
25701378 2015 Celecoxib sensitizes gastric cancer to rapamycin via inhibition of the Cbl-b-regulated PI3K/Akt pathway.
25691332 2015 Ionizing radiation-inducible miR-30e promotes glioma cell invasion through EGFR stabilization by directly targeting CBL-B.
25416956 2014 A proteome-scale map of the human interactome network.
25261476 2014 A multiple sclerosis-associated variant of CBLB links genetic risk with type I IFN function.
25218436 2014 Ubiquitylation-dependent downregulation of Nck regulates its functional activity.
24885194 2014 Ubiquitin ligase Cbl-b represses IGF-I-induced epithelial mesenchymal transition via ZEB2 and microRNA-200c regulation in gastric cancer cells.
24351824 2013 Cbl-b enhances sensitivity to 5-fluorouracil via EGFR- and mitochondria-mediated pathways in gastric cancer cells.
23665906 2013 The role of E3 ubiquitin ligase Cbl proteins in ?-elemene reversing multi-drug resistance of human gastric adenocarcinoma cells.
23663663 2013 Multimeric and differential binding of CIN85/CD2AP with two atypical proline-rich sequences from CD2 and Cbl-b*.
23586056 2013 Ubiquitin ligase Cbl-b is involved in icotinib (BPI-2009H)-induced apoptosis and G1 phase arrest of EGFR mutation-positive non-small-cell lung cancer.
23280105 2013 Casitas B lineage lymphoma b is a key regulator of peripheral tolerance in systemic lupus erythematosus.
23039885 2012 FOXP3, CBLB and ITCH gene expression and cytotoxic T lymphocyte antigen 4 expression on CD4(+) CD25(high) T cells in multiple sclerosis.
22447040 2012 Down-regulation of Cbl-b by bufalin results in up-regulation of DR4/DR5 and sensitization of TRAIL-induced apoptosis in breast cancer cells.
22194214 2012 Replication study of 10 genes showing evidence for association with multiple sclerosis: validation of TMEM39A, IL12B and CBLB [correction of CLBL] genes.
22158902 2011 Autoinhibition and phosphorylation-induced activation mechanisms of human cancer and autoimmune disease-related E3 protein Cbl-b.
21900206 2011 A directed protein interaction network for investigating intracellular signal transduction.
21807564 2011 Th3 immune responses in the progression of leprosy via molecular cross-talks of TGF-?, CTLA-4 and Cbl-b.
21768087 2011 c-Cbl and Cbl-b ligases mediate 17-allylaminodemethoxygeldanamycin-induced degradation of autophosphorylated Flt3 kinase with internal tandem duplication through the ubiquitin proteasome pathway.
21706016 2011 Selected reaction monitoring mass spectrometry reveals the dynamics of signaling through the GRB2 adaptor.
21645455 2011 [Expressions of c-Cbl, Cbl-b and EGFR and its role of prognosis in NSCLC].
21558139 2011 Expression and function of Cbl-b in T cells from patients with systemic lupus erythematosus, and detection of the 2126 A/G Cblb gene polymorphism in the Mexican mestizo population.
21453975 2011 Disruption of HLA-DR raft, deregulations of Lck-ZAP-70-Cbl-b cross-talk and miR181a towards T cell hyporesponsiveness in leprosy.
21346257 2011 CBL, CBLB, TET2, ASXL1, and IDH1/2 mutations and additional chromosomal aberrations constitute molecular events in chronic myelogenous leukemia.
21248249 2011 Visualizing the role of Cbl-b in control of islet-reactive CD4 T cells and susceptibility to type 1 diabetes.
21037273 2011 Association of the CBLB gene with multiple sclerosis: new evidence from a replication study in an Italian population.
20936779 2010 A human MAP kinase interactome.
20525694 2010 The N terminus of Cbl-c regulates ubiquitin ligase activity by modulating affinity for the ubiquitin-conjugating enzyme.
20453840 2010 Variants within the immunoregulatory CBLB gene are associated with multiple sclerosis.
20400514 2010 Cbl-b is a novel physiologic regulator of glycoprotein VI-dependent platelet activation.
20395198 2010 Cbl-b and itch: key regulators of peripheral T-cell tolerance.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
20038312 2010 [Expression of c-Cbl, Cbl-b, and epidermal growth factor receptor in gastric carcinoma and their clinical significance].
19834503 2009 Replication of CD58 and CLEC16A as genome-wide significant risk genes for multiple sclerosis.
19549985 2009 PKC-theta modulates the strength of T cell responses by targeting Cbl-b for ubiquitination and degradation.
19546888 2009 Cbl negatively regulates JNK activation and cell death.
19506219 2009 Risk alleles for multiple sclerosis in multiplex families.
19380743 2009 Charting the molecular network of the drug target Bcr-Abl.
19268472 2009 Novel insights into the mechanisms of CIN85 SH3 domains binding to Cbl proteins: solution-based investigations and in vivo implications.
19028597 2009 Maturation of human dendritic cells is accompanied by functional remodelling of the ubiquitin-proteasome system.
18680311 2008 Interactions between the three CIN85 SH3 domains and ubiquitin: implications for CIN85 ubiquitination.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18316398 2008 A tale of two Cbls: interplay of c-Cbl and Cbl-b in epidermal growth factor receptor downregulation.
18201552 2008 Identification and functional analysis of CBLB mutations in type 1 diabetes.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17679095 2007 Structural basis for ubiquitin-mediated dimerization and activation of the ubiquitin protein ligase Cbl-b.
17475912 2007 Novel c-CBL and CBL-b ubiquitin ligase mutations in human acute myeloid leukemia.
17255943 2007 CIN85, a Cbl-interacting protein, is a component of AMAP1-mediated breast cancer invasion machinery.
17235393 2007 The ubiquitin ligase Cbl-b limits Pseudomonas aeruginosa exotoxin T-mediated virulence.
17209142 2007 Interaction analysis of the CBLB and CTLA4 genes in type 1 diabetes.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
17020880 2006 Atypical polyproline recognition by the CMS N-terminal Src homology 3 domain.
16868939 2006 Ubiquitin ligase gene expression in healthy volunteers with 20-day bedrest.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
16525057 2006 Glial cell line-derived neurotrophic factor-dependent recruitment of Ret into lipid rafts enhances signaling by partitioning Ret from proteasome-dependent degradation.
16503409 Stromal-cell-derived factor-1/CXCL12-induced chemotaxis of a T cell line involves intracellular signaling through Cbl and Cbl-b and their regulation by Src kinases and CD45.
16459459 2005 The CBLB gene and Graves' disease in children.
16228008 2005 Cbl promotes clustering of endocytic adaptor proteins.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15922296 2005 T cell-to-T cell clustering enhances NF-kappaB activity by a PI3K signal mediated by Cbl-b and Rho.
15629882 2005 CBLB variants in type 1 diabetes and their genetic interaction with CTLA4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15315962 2005 Regulation of stem cell factor receptor signaling by Cbl family proteins (Cbl-b/c-Cbl).
15273720 2004 Cbl-b interacts with ubiquitinated proteins; differential functions of the UBA domains of c-Cbl and Cbl-b.
15231748 2004 Functional proteomics mapping of a human signaling pathway.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14661060 2004 Cbl-c suppresses v-Src-induced transformation through ubiquitin-dependent protein degradation.
14604964 2004 Negative regulation of FcepsilonRI-mediated mast cell activation by a ubiquitin-protein ligase Cbl-b.
12935897 2003 The Cbl proteins are binding partners for the Cool/Pix family of p21-activated kinase-binding proteins.
12907674 2003 WW domain HECT E3s target Cbl RING finger E3s for proteasomal degradation.
12880961 2003 Neuroblastoma oligo-capping cDNA project: toward the understanding of the genesis and biology of neuroblastoma.
12829691 2003 Atypical recognition consensus of CIN85/SETA/Ruk SH3 domains revealed by target-assisted iterative screening.
12771181 2003 Cbl-b negatively regulates B cell antigen receptor signaling in mature B cells through ubiquitination of the tyrosine kinase Syk.
12697763 2003 Negative regulation of T cell antigen receptor-mediated Crk-L-C3G signaling and cell adhesion by Cbl-b.
12577067 2003 A proteomics strategy to elucidate functional protein-protein interactions applied to EGF signaling.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12218189 2002 Cbl-directed monoubiquitination of CIN85 is involved in regulation of ligand-induced degradation of EGF receptors.
12177062 2002 CIN85 participates in Cbl-b-mediated down-regulation of receptor tyrosine kinases.
12093870 2002 Cbl-b positively regulates Btk-mediated activation of phospholipase C-gamma2 in B cells.
11857085 2002 Differential expression and signaling of CBL and CBL-B in BCR/ABL transformed cells.
11826757 2002 Regulation of immune responses by E3 ubiquitin-protein ligases.
11526404 2001 Proteolysis-independent regulation of PI3K by Cbl-b-mediated ubiquitination in T cells.
11406619 2001 A positive regulatory role for Cbl family proteins in tumor necrosis factor-related activation-induced cytokine (trance) and CD40L-mediated Akt activation.
11375397 2001 Cbl-b-dependent coordinated degradation of the epidermal growth factor receptor signaling complex.
11087752 2001 Cbl-b, a RING-type E3 ubiquitin ligase, targets phosphatidylinositol 3-kinase for ubiquitination in T cells.
11053437 2001 Evidence for direct interaction between Sprouty and Cbl.
10086340 1999 cbl-b inhibits epidermal growth factor receptor signaling.
10074432 1999 A direct interaction between the adaptor protein Cbl-b and the kinase zap-70 induces a positive signal in T cells.
10022120 1999 Tyrosine phosphorylation and complex formation of Cbl-b upon T cell receptor stimulation.
9614102 1998 The CBL-related protein CBLB participates in FLT3 and interleukin-7 receptor signal transduction in pro-B cells.
9399639 1997 Cbl-b, a member of the Sli-1/c-Cbl protein family, inhibits Vav-mediated c-Jun N-terminal kinase activation.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
7784085 1995 Cloning and characterization of cbl-b: a SH3 binding protein with homology to the c-cbl proto-oncogene.