Property Summary

NCBI Gene PubMed Count 33
PubMed Score 60.68
PubTator Score 50.36

Knowledge Summary

Patent

No data available

Expression

Gene RIF (20)

PMID Text
26593974 ETO2 and IRF2BP2 interacting with the NCOR1/SMRT co-repressor complex, suppresses the expression of erythroid genes until erythroid differentiation.
25974097 MTG16 co-repressor promotes degradation of HIF1alpha in lymphoblasts.
24349473 study defined eight additional recurrently mutated genes in SMZL; these genes are CREBBP, CBFA2T3, AMOTL1, FAT4, FBXO11, PLA2G4D, TRRAP and USH2A.
24127550 Findings are unprecedented and indicate that the DHH-RHEBL1 fusion transcript is a novel recurrent feature in the changing landscape of CBFA2T3-GLIS2-positive childhood AML.
23840896 Expression of MTG16 reduced glycolytic metabolism while mitochondrial respiration and formation of reactive oxygen species increased.
23251453 presence of MTG16 in this complex, and its contributions to transcriptional repression both required Kaiso binding to its binding site on DNA, establishing MTG16-Kaiso binding as functionally relevant in Kaiso-dependent transcriptional repression
23153540 Identification of a cryptic chromosome 16 inversion (inv(16)(p13.3q24.3)) in 27% of pediatric acute megakaryoblastic leukemia cases, which encodes a CBFA2T3-GLIS2 fusion protein.
23127762 Data indicate taht ETO2/CBFA2T3 regulates GATA-1 target genes critical for erythroid differentiation, and the decrease of ETO2 levels during erythroid differentiation would contribute to the activation of these targets.
22443175 An evolutionary conserved GATA binding site is critical in transcriptional regulation of the MTG16 promoter.
22420028 Our data indicate that the CBFA2T3/ACSF3 locus is a novel recurrent oncogenic target of immunoglobulin heavy chain translocations, which might contribute to the pathogenesis of pediatric GC-derived B-cell lymphoma.
22010104 Alternative NLI complexes mediate gamma-globin transcription or silencing through long-range locus control region interactions involving an intergenic site of noncoding RNA transcription and that ETO2 is critical to this process.
20138877 Study provides the first evidence that MTG16b is a dual AKAP capable of binding plexins.
20116376 Data show that ZNF651 is a ZNF652 paralogue that shares a common DNA binding sequence with ZNF652 and represses target gene expression through the formation of a CBFA2T3-ZNF651 corepressor complex.
18950503 Both wild type MTGs and chimeric AML1-MTG proteins display in vitro RNA-binding properties
18656694 RUNX1-MTG16 fusion gene in acute myeloblastic leukemia with t(16/21)(q24'q22) is reported.
18586123 ETO family member-mediated oligomerization and repression can be distinct events and that interaction between ETO family members and hSIN3B or N-CoR may not necessarily strengthen transcriptional repression.
18456661 CBFA2T3 interacts with ZNF652 to repress HEB expression, and in addition CBFA2T3 interacts with the HEB protein to inhibit its activator function.
16966434 The transcriptional repression of growth factor independent-1 (GFI-1), a previously characterized ETO effector zinc finger protein, was shown to be enhanced by CBFA2T1, but to a lesser extent by CBFA2T2 and CBFA2T3.
12183414 CBFA2T3 (MTG16) is a putative breast tumor suppressor gene from the breast cancer loss of heterozygosity region at 16q24.3.
11999578 In the first pediatric leukemia case in whom AML1-MTG16 was identified, the breakpoint of MTG16 was determined, and suggested as a possible characteristic of secondary leukemia.

AA Sequence

MPASRLRDRAASSASGSTCGSMSQTHPVLESGLLASAGCSAPRGPRKGGPAPVDRKAKASAMPDSPAEVK      1 - 70
TQPRSTPPSMPPPPPAASQGATRPPSFTPHTHREDGPATLPHGRFHGCLKWSMVCLLMNGSSHSPTAING     71 - 140
APCTPNGFSNGPATSSTASLSTQHLPPACGARQLSKLKRFLTTLQQFGSDISPEIGERVRTLVLGLVNST    141 - 210
LTIEEFHSKLQEATNFPLRPFVIPFLKANLPLLQRELLHCARLAKQTPAQYLAQHEQLLLDASASSPIDS    211 - 280
SELLLEVNENGKRRTPDRTKENGSDRDPLHPEHLSKRPCTLNPAQRYSPSNGPPQPTPPPHYRLEDIAMA    281 - 350
HHFRDAYRHPDPRELRERHRPLVVPGSRQEEVIDHKLTEREWAEEWKHLNNLLNCIMDMVEKTRRSLTVL    351 - 420
RRCQEADREELNHWARRYSDAEDTKKGPAPAAARPRSSSAGPEGPQLDVPREFLPRTLTGYVPEDIWRKA    421 - 490
EEAVNEVKRQAMSELQKAVSDAERKAHELITTERAKMERALAEAKRQASEDALTVINQQEDSSESCWNCG    491 - 560
RKASETCSGCNAARYCGSFCQHRDWEKHHHVCGQSLQGPTAVVADPVPGPPEAAHSLGPSLPVGAASPSE    561 - 630
AGSAGPSRPGSPSPPGPLDTVPR                                                   631 - 653
//

Text Mined References (47)

PMID Year Title
26593974 2015 Control of developmentally primed erythroid genes by combinatorial co-repressor actions.
25974097 2015 Myeloid translocation gene-16 co-repressor promotes degradation of hypoxia-inducible factor 1.
24349473 2013 Whole exome sequencing identifies novel recurrently mutated genes in patients with splenic marginal zone lymphoma.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24133439 2013 Genome-wide association study of autistic-like traits in a general population study of young adults.
24127550 2013 DHH-RHEBL1 fusion transcript: a novel recurrent feature in the new landscape of pediatric CBFA2T3-GLIS2-positive acute myeloid leukemia.
23840896 2013 The transcriptional co-repressor myeloid translocation gene 16 inhibits glycolysis and stimulates mitochondrial respiration.
23251453 2012 Kaiso directs the transcriptional corepressor MTG16 to the Kaiso binding site in target promoters.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23153540 2012 An Inv(16)(p13.3q24.3)-encoded CBFA2T3-GLIS2 fusion protein defines an aggressive subtype of pediatric acute megakaryoblastic leukemia.
23127762 2013 Role of transcriptional corepressor ETO2 in erythroid cells.
22443175 2012 The leukemia associated nuclear corepressor ETO homologue genes MTG16 and MTGR1 are regulated differently in hematopoietic cells.
22420028 2012 The CBFA2T3/ACSF3 locus is recurrently involved in IGH chromosomal translocation t(14;16)(q32;q24) in pediatric B-cell lymphoma with germinal center phenotype.
22010104 2011 Distinct Ldb1/NLI complexes orchestrate ?-globin repression and reactivation through ETO2 in human adult erythroid cells.
20150326 2010 Specificity and spatial dynamics of protein kinase A signaling organized by A-kinase-anchoring proteins.
20138877 2010 Myeloid translocation gene 16b is a dual A-kinase anchoring protein that interacts selectively with plexins in a phospho-regulated manner.
20116376 2010 CBFA2T3-ZNF651, like CBFA2T3-ZNF652, functions as a transcriptional corepressor complex.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
18950503 2008 Novel RNA-binding properties of the MTG chromatin regulatory proteins.
18656694 2008 RUNX1-MTG16 fusion gene in acute myeloblastic leukemia with t(16;21)(q24;q22): case report and review of the literature.
18586123 2008 Transcriptional repression by leukaemia-associated ETO family members can be independent of oligomerization and coexpressed hSIN3B and N-CoR.
18456661 2008 CBFA2T3-ZNF652 corepressor complex regulates transcription of the E-box gene HEB.
16966434 2006 ZNF652, a novel zinc finger protein, interacts with the putative breast tumor suppressor CBFA2T3 to repress transcription.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16815842 2006 ErbB-4 s80 intracellular domain abrogates ETO2-dependent transcriptional repression.
16616331 2006 The tetramer structure of the Nervy homology two domain, NHR2, is critical for AML1/ETO's activity.
15676213 2005 The Leukemia-associated ETO homologues are differently expressed during hematopoietic differentiation.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15470020 2004 A-kinase anchoring proteins interact with phosphodiesterases in T lymphocyte cell lines.
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
15231665 2004 AML1-ETO decreases ETO-2 (MTG16) interactions with nuclear receptor corepressor, an effect that impairs granulocyte differentiation.
15203199 2004 The MTG proteins: chromatin repression players with a passion for networking.
14703694 2003 Interactions between the leukaemia-associated ETO homologues of nuclear repressor proteins.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12559562 2003 The ETO (MTG8) gene family.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12242670 2002 The transcriptional corepressor MTG16a contains a novel nucleolar targeting sequence deranged in t (16; 21)-positive myeloid malignancies.
12213200 2002 Sequencing, transcript identification, and quantitative gene expression profiling in the breast cancer loss of heterozygosity region 16q24.3 reveal three potential tumor-suppressor genes.
12183414 2002 CBFA2T3 (MTG16) is a putative breast tumor suppressor gene from the breast cancer loss of heterozygosity region at 16q24.3.
11999578 2002 A pediatric case of secondary leukemia associated with t(16;21)(q24;q22) exhibiting the chimeric AML1-MTG16 gene.
11823486 2002 Identification and characterization of myeloid translocation gene 16b as a novel a kinase anchoring protein in T lymphocytes.
11533236 2001 ETO, a target of t(8;21) in acute leukemia, makes distinct contacts with multiple histone deacetylases and binds mSin3A through its oligomerization domain.
11224496 2001 AML1/MTG16 fusion gene from a t(16;21)(q24;q22) translocation in treatment-induced leukemia after breast cancer.
10995019 2000 AML1-MTG16 fusion gene in therapy-related acute leukemia with t(16;21)(q24;q22): two new cases.
9790752 1998 CBFA2T1, a gene rearranged in human leukemia, is a member of a multigene family.
9596646 1998 The partner gene of AML1 in t(16;21) myeloid malignancies is a novel member of the MTG8(ETO) family.
9447981 1998 The AML1-MTG8 leukemic fusion protein forms a complex with a novel member of the MTG8(ETO/CDR) family, MTGR1.