Property Summary

NCBI Gene PubMed Count 729
PubMed Score 2274.01
PubTator Score 2416.67

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Glaucoma 135 3.411 1.7
Heart conduction disease 65 0.0 2.0

Expression

  Differential Expression (35)

Protein-protein Interaction (10)

Gene RIF (631)

PMID Text
27094744 Hypoxic down-regulation of constitutive endocytosis is HIF-independent, and involves caveolin-1-mediated inhibition of dynamin-dependent, membrane raft endocytosis.
26876307 Data show that loss of epithelial membrane protein 2 (EMP2) is involved in sphingosylphosphorylcholine (SPC)-induced phosphorylation of keratin 8 (K8) via ubiquitination of protein phosphatase 2 (PP2A) through alpha4 phosphoprotein by caveolin-1 (cav-1).
26837700 Cav-1 has a novel role in TCR/Lck spatial distribution upon TCR triggering, which controls T-cell fate toward a regulatory phenotype
26828798 Decreased caveolin-1 expression is associated with increased expression and phosphorylation levels of eNOS in endothelial cells stimulated by microgravity, which causes a dissociation of eNOS from caveolin-1 complexes.
26797118 Ankrd13 proteins cooperate with VCP to regulate the lysosomal trafficking of ubiquitinated Cav-1.
26794448 data provides novel insight into the regulation of CAV1 gene by histone H3 modifications and enhance the amplitude of the cancer epigenome
26725982 This study reports an unanticipated function of ROR1 as a scaffold of cavin-1 and caveolin-1, two essential structural components of caveolae.
26717806 Cav-1 may regulate the hepatocyte-like differentiation of human adipose-derived stem cellsby modulating mitogen-activated protein kinase kinase/MAPK signaling.
26626726 hypothesize that focal adhesion signaling pathways such as PI3K/Akt signaling may be negatively regulated by Cav-1 during mesenchymal stem cell osteogenesis
26615831 Study elucidated the relationship between TLR5 and caveolin-1 at the transcriptional and translational levels using human cells, results suggest that caveolin-1 is a crucial regulator for maintaining and controlling TLR5 expression.
26602865 Mutant CAV1 forms caveolae structures similar to wild-type but leads to increases in nitric oxide bioavailability.
26566034 CAV1 has a role in the tumor microenvironment of mature T-cell malignancies
26543228 Data show that caveolin-1 (Cav-1) expression in MCF7 breast cancer epithelial cells represses NF-E2-related factor 2 (Nrf2) and superoxide dismutase (MnSOD).
26543085 CAV-1 and -2 have roles in progression of prostate neoplasms
26539466 serum Cav1 might be a novel biomarker in the diagnosis of IPAH with fare sensitivity and good specificity. Second, Cav1 might be used to make differential diagnosis between COPD-PH and IPAH group
26503358 knockdown of Cav-1 was also able to significantly downregulate the protein expression level of Notch-1, p-Akt and p-NF-kappaB p65 in cisplatin-resistant ovarian cancer cells.
26497787 Familial linkage studies for primary angle-closure glaucoma have been performed and identified CAV1 causative primary angle-closure glaucoma disease
26475177 The prevalent CAV1 gene variant rs926198 is associated with metabolic syndrome in separate Caucasian and Hispanic cohorts
26474461 Loss of Cav1 in head and neck squamous cell carcinoma enables tumor cells to undergo epithelial-mesenchymal transition.
26357463 LPS-induced Cav-1 phosphorylation in pulmonary microvascular endothelial cells may lead to an increase in transcellular permeability prior to an increase in paracellular permeability in a Src-dependent manner.
26354438 Cholesterol and CAV-1 modulate the function and dynamics of the slow channel congenital myasthenia syndrome alphaC418W nicotinic acetylcholine receptor mutation.
26315660 Data show that caveolin 1 expression in brain metastasis was associated with poor prognosis and an increased risk of death.
26307673 Loss of PTEN in melanoma increases CAV1-mediated dissociation of beta-catenin from membranous E-cadherin, which may promote senescence bypass and metastasis.
26259513 Suggest that IFITM1 promotes the aggressiveness of colorectal cancer cells via caveolin-1 signaling.
26255449 Our findings demonstrated a link between Caveolin-1 expression and the aggressiveness of ovarian cancer
26251082 High CAV1 expression is associated with colon tumors.
26189259 Microarray data of the expression level of key genes reveals that CAV1 is critical for cervical cancer invasion and metastasis.
26172389 Caveolin-1 protein may be an effective predictor for determining the outcome of T-DM1 treatment in breast cancer patients.
26169283 These results suggest that HIV interferes with cholesterol efflux by high-density lipoprotein in human aortic endothelial cells through the disruption of Cav-1s' cellular distribution.
26169283 HIV-1 Nef induces phosphorylation of CAV1 in endothelial cells
26138883 CAV1 expression was positively related to IGF-1R expression in human hepatocellular carcinoma tissues; CAV1 confers resistance of hepatoma cells to anoikis by activating IGF-1 pathway.
26123189 higher protein expression in tumor is associated with both improved response rate and overall survival in advanced non-small-cell lung cancer
26086560 Cavin-1 and cavin-2 are strongly expressed within caveolae-like structures within liver sinusoidal endothelial cells of the hepatitis C-related cirrhotic liver and cavin-1 would play a critical role in regulating aspects of caveolin-1.
26085308 Study demonstrates the importance of CAV1 interaction with the cytoskeleton, which includes shape change and adhesion. Cav1 modulates the focal adhesion complex through vinculin and participates in the tension forces during adhesion and clot retraction.
26072376 study suggest that CAV1 may not act as a potential biomarker of uterine malignant mesenchymal tumors
26066055 results indicate that the two SNPs (Cav-1 rs1049334 and ROCK1 rs35996865) and genotypes with a combination of 2-4 risk alleles were associated with the risk of ccRCC.
26065715 In PC cell lines, disruption/depletion of caveolae/Cav-1 reduces proliferation, colony formation, and invasion.
26054531 Our study shows that elevated CAV1, observed in patients with endometrial cancer, is linked to enhanced malignancy of endometrial cancer cells, as evidenced by increased migration, invasion and anchorage-independent growth.
26025399 The results suggested that differential levels of P-glycoprotein, Caveolin-1 and Fatty acid synthase except CYP450 play a major role in acquired resistant phenotype in bladder cancer.
26015768 The minor allele G of rs17588172 in the CAV1-CAV2 locus is associated with decreased expression of CAV1 and CAV2 in some tissues, marginally with intraocular pressure elevation, and consequently with increased susceptibility to high-tension glaucoma.
25998683 Under the regulation of Rab5, the fused vesicles are targeted to early endosomes and thus deliver the internalized TbetaRI to the caveolin-1 and EEA1 double-positive early endosomes (caveolin-1-positive early endosomes).
25953654 The data revealed a significant association between CAV1 variant rs3807989 and Atrial Fibrillation in the Chinese Han population
25945613 downregulation of CAV1 and enhanced autophagy level were observed in human breast cancer cells and tissues.
25940406 the results of our genetic analysis do not support the involvement of CAV1 in morphea.
25898808 study reports heterozygous de novo disease-causing mutations in CAV1 gene in 2 patients presenting with neonatal onset of generalized loss of subcutaneous fat but sparing the buttocks with additional distinctive phenotypic features; report extends the spectrum of disorders due to CAV1 mutations to include one subtype of lipodystrophy
25893292 these findings demonstrate that syntenin may act as an important positive regulator of TGF-b signaling by regulating caveolin-1-mediated internalization of TbRI; thus, providing a novel function for syntenin that is linked to cancer progression.
25892494 A novel chimeric aequorin fused with caveolin-1 reveals a sphingosine kinase 1-regulated Ca(2) microdomain in the caveolar compartment.
25877996 data suggest the potential for Cav-1 as a possible novel therapeutic target in NPC treatment
25853335 Interactions between ABCB1 and CAV1 with APOL1 may influence allograft failure for transplanted kidneys from African American donors.
25848073 disruption of cav-1 decreases basolateral K(+) channel activity and depolarizes the cell membrane potential in the DCT1 at least in part by suppressing the stimulatory effect of c-Src on Kcnj10
25842166 The CAV1 expression was increased during colonocyte differentiation and mediated butyrate-induced differentiation and apoptosis of HT29 cells.
25822667 Using in silico and in vitro analysis we show that Cavin-1 is expressed in myogenic Rhabdomyosarcoma tumors and human and primary mouse RMS cultures. Cavin-1 or Cav-1 knockdown led to impairment of cell proliferation and migration.
25787790 donor Cav1 genotype correlates with long-term pancreas graft function
25707739 placental expression reduced in pre-eclampsia
25672415 suggesting that N-SH2 domain of SHP-2 is responsible for the binding of caveolin-1 and contributes to the regulation of Src phosphorylation and activation following ROS-induced oxidative stress in brain astrocytes
25665524 the AKT/miR-199a-5p/CAV1 pathway is identified as a regulator of innate immunity, which is dysfunctional in cystic fibrosis macrophages contributing to lung hyper-inflammation.
25658354 Interaction of Cav1 with its receptor EGFR inhibits signaling and reduces cell proliferation, supporting a tumor suppressor function for Cav1.
25658089 Selective targeting of this SMAD-independent, p38-MAPK/Cav-1-dependent pathway is likely to be effective in the treatment of pathological conditions characterized by TGF-beta signaling and myofibroblast activation.
25645930 The lipid raft scaffolding protein caveolin-1 interacts with the STIM1-Orai1 complex to increase channel activity.
25633184 Caveolin-1 accumulation in the tongue cancer tumor microenvironment is significantly associated with poor prognosis
25632186 The loss of stromal CAV-1 expression in colorectal carcinoma was associated with poor prognosis.
25626893 caveolin-1 may at least in part determine gene transfer efficiency and cytotoxicity of polyethyleneimine in mammalian cell lines.
25588833 cavin3 is recruited to the caveolae coat by cavin1 to interact with caveolin1 and regulate the duration time of caveolae at the plasma membrane.
25575822 Data show that caveolin-1 (Cav-1) is up-regulated, but collagen I (COL I) is down-regulated, in chronologically-aged skin of human and mouse.
25551286 The authors not only show that langerin and caveolin-1 co-localize at the cell membrane and in vesicles but that caveolin-1 mediated HIV-1 uptake is an intrinsic restriction mechanism present in human Langerhans cells that prevents HIV-1 infection.
25551286 HIV-1 Nef induces phosphorylation of CAV1 in endothelial cells
25551286 Knockdown of caveolin 1 (CAV1) by siRNA enhances HIV-1 infection in human Langerhans cells
25550395 Cav1 ectopic expression reverses EMT in human peritoneal mesenchymal cell from peritoneal dialysis patients.
25525164 The implication of the caveolin genes, CAV1/CAV2, as a common genetic factor influencing both IOP variations and POAG may provide new insights of the underlying mechanism leading to glaucoma and glaucomatous visual field loss.
25489222 The significant association of three common variants in TMCO1, ATOH7, and CAV1 with primary open angle, primary angle closure, and pseudoexfoliation glaucoma was found in Pakistani cohorts.
25455218 In conclusion these data suggest that Streptococcus pneumoniae PspC-promoted uptake via the polymeric immunoglobulin receptor of epithelial cells is mediated by both clathrin and caveolin dependent pathway.
25408776 HIV-1 Nef induces phosphorylation of CAV1 in endothelial cells
25407491 We further confirmed that miR-103/107 inhibited P-gp function in gastric cancer SGC7901/ADR cells. Finally, we verified that caveolin-1 (Cav-1), a critical component of lipid rafts, was a target of miR-103/107
25397596 The findings suggest that large conductance Ca(2)-activated potassium (BKCa) channels is a critical target for suppression by caveolin-1 in suppressing proliferation and invasion of breast cancer cells.
25351339 Cav-1 protein was up-regulated in response to the acquisition of anoikis resistance and the up-regulation of Cav-1 played an important role in regulation of several cancer cell behaviors.
25339030 Low caveolin-1 expression is associated with gastric cancer.
25337248 Suggest that overexpressed SPP1, PAI and caveolin-1 were linked to carcinogenesis and progression, and thus they may serve as potential prognostic factors in oral squamous cell carcinoma.
25313138 Results suggest that CAV1 could function as a potent tumor suppressor in ARMS tumors. Inhibition of CAV1 function therefore, could contribute to aberrant cell proliferation, leading to ARMS development.
25246063 The results showed that the G allele of the Cav-1 G14713A and the A allele of the Cav-1 T29107A are risky genetic factors for renal cell carcinoma susceptibility.
25196315 CAV1 rs3807989 may contribute to a decreased atrial fibrillation risk in Chinese Han populations
25192721 we found that along with these factors, CAV1 acts in cohort in reducing cell migration and inducing apoptosis.
25180681 The role of CAV1 in hepatocellular carcinoma progression was explored in this study.
25148256 reciprocal activating crosstalk between c-Met and CAV1 promoted oncogenic signaling of c-Met contributed to the initiation and progression of HCC.
25123270 we attempt to abridge the relationship between caveolin-1 and oral squamous cell carcinoma [review]
25120818 The SNP rs3807989 in CAV1 gene is not associated with AF in Chinese Han patients.
25117072 CAV1 rs729949 was associated with increased risk of hepatocellular carcinoma.
25085904 The role of caveolin-1 in mediating the chemoresistance of breast cancer stem cells via beta-catenin/ABCG2 regulation.
25017566 Caveolin-1 is a positive regulator for E2-induced cell growth by promoting auptophagy and inhibiting apoptosis in BT474 cells.
25002533 Data show that caveolin-1 is necessary for optimal KSR1-dependent ERK activation by growth factors and oncogenic Ras.
24998359 Interactions of caveolin-1 scaffolding and intramembrane regions containing a CRAC motif with cholesterol in lipid bilayers.
24969108 In overfed human subjects, CAV1 protein expression was correlated with increased adipocyte size, but not with increased adipocyte number.
24968949 Data suggest that the role for caveolin-1 (CAV-1) in promoting bladder cancer metastasis presents CAV-1 and related pathways as potential therapeutic targets in invasive bladder cancer.
24967418 the induction of EMT was found in Cav-1-knock down cells treated with NO, suggesting that EMT was through Cav-1-independent pathway.
24949874 The loss of stromal Cav-1 in pancreatic cancer was an independent prognostic indicator, thus suggesting that stromal Cav-1 may be an effective therapeutic target for patients with pancreatic cancer
24939878 Using gene manipulation strategies, authors reveal for the first time that Cav-1 plays an essential role in CSC regulation and aggressiveness of SWCNT-transformed cells partly through p53 dysregulation.
24909339 Human uterine leiomyomas in vitro express low levels of Cav-1 compared to normal myometrium, which may result from estrogen inhibition.
24885118 CAV1 promoter hypermethylation is a frequent event in human esophageal carcinomas and is associated with early neoplastic progression in Barrett's esophagus.
24840271 Data suggest that Src activates EGFR through the interaction of both Src-EGFR and Src-caveolin-1, and then antagonizes TRAIL-induced apoptosis in gastric cancer cells.
24831264 The expression of caveolin-1 was positively correlated with an advanced pathologic stage. Thus, caveolin-1 could act as a predictor of a poor prognosis in patients with large cell lung carcinoma
24815842 Our findings suggest that Cav1 may play a critical role in the etiology of sarcopenia, and the A allele of Cav1 G14713A may serve as an early marker for detection of sarcopenia and severe sarcopenia.
24801727 The present review summarizes the current knowledge and views on the regulatory role of CAV1 on the cholesterol homeostasis with emphasis on the association of CAV1 with ABCA1 and ABCG1. [review]
24782297 our results showed cav-1 expression in all odontogenic cysts and 58% of ameloblastomas.
24778029 Our findings suggested that CAV1 genotype may determine the individual susceptibility to gastric cancer
24742020 Cav-1 is implicated in the pathogenesis of asthma and chronic inflammatory respiratory diseases and influences inflammation, fibrosis, smooth muscle contractility, regulation of apoptosis,cell senescence,epithelial barrier function and homeostasis.
24727585 Cav-1 competitively interacts with the ATG12-ATG5 system to suppress the formation and function of the latter in lung epithelial cells.
24710718 Cav-1 could be a cellular defense protein against alcoholic hepatic injury through inhibiting reactive nitrogen species and regulating EGFR/STAT3/iNOS-signaling cascades.
24705869 hSlo1c associates with Cav-1 in human brain microvascular endothelial cells. This association boosted Cav-1 transfer from the cell membrane to the cytoplasm. It is crucial for regulating the permeability of the blood-tumor barrier.
24659799 stimulates Rab5 activation, leading to increased Rac1 activity and cell migration
24648521 these data provide the first detailed analysis of Cav-1 binding to one of its most significant client proteins, eNOS.
24643062 Caveolin-1 in lipid rafts interacts with dengue virus NS3 during polyprotein processing and replication in vascular endothelial cells.
24625804 These results suggest a new model in which caveolin-1 might be involved in Salmonella entry via its interaction with SopE and Rac1, leading to enhanced membrane ruffling for phagocytosis into host cells.
24621537 conclude that the GG genotype of CAV-1 is protective, associated with a decreased overall mortality
24609521 Cav-1 plays a duplex role in tumorigenesis and tumor progression in non-small cell lung cancer
24604116 Caveolin 1 knockdown inhibits the proliferation, migration and invasion of human breast cancer BT474 cells.
24590865 Breast cancer nodal metastasis correlates with tumour and lymph node methylation profiles of Caveolin-1 and CXCR4.
24578173 African Americans may be predisposed to systemic sclerosis-related interstitial lung disease due to low baseline caveolin-1 levels in their monocytes, potentially affecting signaling, migration, and fibrocyte differentiation.
24578133 HIV-1 Nef induces phosphorylation of CAV1 in endothelial cells
24576892 These findings indicate that CAV1 interacts with ABCG1 and regulates ABCG1-mediated cholesterol efflux.
24572674 CAV1/CAV2 SNPs were associated significantly with primary open-angle glaucoma overall, particularly among women.
24533441 Caveolin-1 expression is decreased in samples of non-small cell lung cancer.
24454806 Cav-1 is an important anti-AF signaling mediator by conferring its anti-fibrotic effects in atrium
24454730 GLI1 may be attributed to Cav-1 up-regulation which plays an important role in GLI1-driven epithelial-mesenchymal transition phenotype in hepatocellular carcinoma.
24427291 Phosphocaveolin-1 enforces tumor growth and chemoresistance in rhabdomyosarcoma.
24397980 These results demonstrate for the first time that adiponectin inhibits TNFalpha-induced inflammatory response via Cav1-mediated ceramidase recruitment and activation in an AdipoR1-dependent fashion.
24390341 caveolin-1 is involved in the regulation of lipoprotein transcytosis across endothelial cells and in the regulation of vascular inflammation.
24354620 caveolin-1-enriched microdomains have a role in Gas6-induced tissue factor expression in endothelial cells
24255086 Altered expression of caveolin-1 in the thyroid epithelial and stromal compartments may be involved in the pathogenesis of papillary thyroid carcinoma.
24222128 single nucleotide variation of caveolin-1 gene is associated with upper urothelial tract cancer.
24211445 Clathrin and caveolin-1 have a role in docking of SMAD4 at the cell membrane.
24130882 Glioblastoma-mediated suppression of tumor-associated myeloid cell function is mediated at least in part by CAV1, and importantly, that activity can be restored by suppressing CAV1.
24119769 The combined expression of Cav-1 and pERK serves as an independent biomarker signature with potential merit in renal cell carcinoma surveillance strategies.
24089527 Cav-1 may be a cofactor in the interaction of Derlin-1 and N-glycosylated COX-2 and may facilitate Derlin-1- and p97 complex-mediated COX-2 ubiquitination, retrotranslocation, and degradation.
24065198 An elevated risk of gastric cancer was observed in patients with H. pylori infection combined with the Cav-1 G14713A, but not T29107A genotypes.
24034151 This meta-analysis suggests that rs4236601[A] is associated with increased risk for POAG in Caucasian and Asian populations.
23982252 Down-regulation of stromal Cav-1 expression is associated with esophageal squamous cell carcinoma
23963167 We identified a nominally significant SNP (P < 0.05), rs4236601 in CAV1/CAV2, in primary open angle glaucoma.
23951165 EphA2-induced angiogenesis in ewing sarcoma cells works through bFGF production and is dependent on caveolin-1.
23938946 In this review caveolin-1, the major structural protein of caveolae, is overexpressed in prostate cancer patients.
23934189 caveolin-1 in advanced prostate cancer is present outside of caveolae, because of the lack of cavin-1 expression
23907124 Alterations in Cav-1 and MCT4 expression may mark a critical point in the progression from in situ to invasive breast cancer.
23894397 The presence of a CC genotype in Birmingham is associated with protection from adverse outcomes of immunosuppression treated AAV. Lack of replication in the European cohort may have resulted from low clinical event rates.
23845778 downregulation of caveolin-1 can be significant as Fanconi anemia patients have an elevated predisposition to develop cancer
23836408 Loss of caveolin-1 promotes endothelial-mesenchymal transition during sepsis.
23770857 The tumor-promoting role of cavin-1 in pancreatic cancer was found to be largely dependent on caveolin-1.
23748364 Variation in the donor apolipoprotein L1 (APOL1), caveolin 1 (CAV1), and multi-drug resistance 1 encoding P-glycoprotein genes (ABCB1) are all associated with graft survival after kidney transplantation. [Review]
23743525 Our findings did not correspond with previous positive results, suggesting that CAV1-CAV2 variants studied in the present study are not important risk factors for Normal Tension Glaucoma susceptibility.
23742006 Caveolin-1 overexpression improved barrier function.
23736812 DNA from 4 HPV positive and 4 HPV negative fresh frozen primary HNSCC were subject to comprehensive genome-wide methylation profiling.Pathway analysis of 1168 methylated genes showed 8 signal transduction pathways (CAV1) of which 62% are hypermethylated.
23729330 Loss of caveolin-1 in prostate cancer stroma correlates with reduced relapse-free survival and is functionally relevant to tumour progression.
23723070 Data indicate that AMP-dependent kinases (AMPKalpha1 and AMPKalpha2) inhibit caveolin-1 phosphorylation by stabilizing the interaction between c-Abl and Prdx-1.
23723060 apoE mediates the effects of leptin on vascular lesion formation by stabilizing cav-1-enriched cell membrane microdomains in smooth muscle cells, thus allowing NADPH oxidase assembly and ROS-mediated mitogenic signalling.
23717204 Pilus phase variation switches gonococcal adherence to invasion by caveolin-1-dependent host cell signaling.
23653359 ERK1/2 phosphorylation is under a negative influence by CAV1 during internalization of exosomes.
23645736 Increased plasma caveolin-1 levels are associated with progression of prostate cancer.
23637463 Data indicate that caveolin-1 is a direct binding partner of nuclear factor-erythroid 2-related factor (Nrf2).
23606537 results demonstrate the counterregulatory heme oxygenase-1/CO pathway, which is critical in balancing and limiting the inflammatory response, is defective in cystic fibrosis macrophages through a CAV-1-dependent mechanism, exacerbating the cystic fibrosis macrophage response to lipopolysaccharide
23603343 The A allele of CAV1 G14713A is risky, while the A allele of CAV1 T29107A is protective for the development of childhood leukemia.
23598720 Expression of Cav1 is tightly correlated in both prostate tissues and cell lines and significantly higher in cancer vs. normal tissues.
23598719 Cav-1-overexpressing U-87MG cells display reduced tumorigenicity in an ectopic xenograft mouse model, with marked hypoactivation of MAPK and PI3K/mTOR pathways.
23583521 Caveolin-1 conveys a homeostatic antifibrotic function by regulating TGF-beta1 and its downstream signaling; regulating critical cellular processes involved in tissue repair; antagonizing cell proliferation.(Review)
23580232 FoxO3a (Forkhead Box O3a) deficiency protects Idiopathic Pulmonary Fibrosis (IPF) fibroblasts from type I polymerized collagen matrix-induced apoptosis via caveolin-1 (cav-1) and Fas.
23580180 study investigated the expression of VEGFR-1, VEGFR-3 and caveolin-1 molecules in 183 colorectal cancer tissue specimens and explored their effect in both clinicopathological parameters and disease prognosis
23527097 Loss of epithelial Cav-1 may promote malignant progression and low CAFs Cav-1 level herald worse outcome of GC patient.
23482776 CAV1 T29107A (rs7804372) polymorphism may influence susceptibility to prostate cancer.
23463606 the proper expression of CAV1 is important not only for maintaining the appropriate morphology and size of ECs but it might represent a prospective molecular target for studying key biological mechanisms such as senescence and tumorigenesis.
23460862 The present study revealed the novel role of Cav-1 and underlying mechanism on tumor adhesion.
23442759 stromal CAV1 expression is down-regulated, which leads to the release of a variety of molecules that either enhance the metastatic capacity of endometrial cells or contribute to adenomyosis-associated dysmenorrhea
23428975 Caveolin 1 expression is up-regulated in inflamed periodontal tissues compared to the healthy gingiva.
23404184 Although the exact roles of Cav-1 and IGF-IR in human cancer continue to be a matter of some debate, there is a strong evidence for an association between Cav-1 and IGF-IR in cancer development.[review]
23393366 Our findings suggest that CAV-1 may play a critical role in Hepatocellular carcinoma carcinogenesis
23383114 Caveolin-1 regulates Rac1 activation and rat pulmonary microvascular endothelial hyperpermeability induced by TNF-alpha.
23352616 these results suggest that caveolin-1 is a novel physiological activator of PP5.
23335559 Data indicate that endosomal trafficking of CAV1 depends on ubiquitination of the N-terminal region and the subsequent recruitment of VCP-UBXD1.
23302227 results show that Cav-1 interacts with LRP6 to generate an integrated signaling module that leads to the activation of IGF-IR/IR and results in stimulation of Akt-mTORC1 signaling and aerobic glycolysis in prostate cancer
23300727 Exo70 is involved in caveolin-1 recycling to the plasma membrane during re-adhesion of the cells to the substratum.
23283514 These data provide strong evidence that octarepeats of PrP are critical for the interaction between PrP and Cav-1.
23280667 Caveolin-1 is induced in colon cancer cells in response to K-RAS activating mutations. K-RAS regulates both caveolin-1 expression and other factors affecting caveolin-1 functions in colon cancer-derived cell migration.
23271292 Expression levels of ERBB2, caveolin-1 and DNA-PKcs were increased.
23267770 Loss of Cav1 affects several characteristics associated with aggressive human skin tumors and this protein may be an important modulator of tumor growth and invasion in cutaneous squamous cell carcinoma.
23228128 In sarcoma cells Caveolin-1 expression is associated with protection against doxorubicin-induced cell death. (Review)
23206456 The level of caveolin-1 expression seems to be related to the clinical severity of psoriasis, and may play a role in the abnormal keratinocyte hyperplasia.
23203033 positive fibroblastic LC3B correlates with lower invasion, and low expression of fibroblastic Cav-1 is a novel predictor of poor GC prognosis.
23128390 CpG island shore methylation regulates caveolin-1 expression in breast cancer.
23117935 This study demonstrates that caveolin-1 is strongly expressed within caveolae-like structures and associated vesicles within liver sinusoidal endothelial cells of the hepatitis C-related cirrhotic liver.
23114650 There is a divergent control of Cav-1 expression as evidenced in non-cancerous Li-Fraumeni syndrome and some aggressive human cancer cell lines.
23067370 The interplay of Cav-1 with Nef and cholesterol subsequently counters Nef induced impairment of cholesterol efflux by apoA-l.
23067370 HIV-1 Nef induces phosphorylation of CAV1 in endothelial cells
23056496 CAV1 and -2 potentiate epsilon-toxin induced cytotoxicity by promoting toxin oligomerization
23004679 Loss of caveolin-1 from bronchial epithelial cells and monocytes in human subjects with asthma.
22931092 Cav-1 is the key regulator of anchorage independent growth and anoikis resistance in lung carcinoma cells.
22898083 Data suggest that down-regulation of CAV1 suppresses proliferation of lung carcinoma cells and may promote metastasis of lung tumors.
22894556 Transfected HBx significantly suppressed caveolin-1 promoter activity.
22883991 The reduced expression of caveolin-1 in lung tissues of idiopathic pulmonary fibrosis might be related to disease development and progression.
22883195 Differential depot-specific expressions of caveolin-1 are present in human subcutaneous and omental adipose tissues. A low expression of caveolin-1 in omental adipose tissue may contribute to the pathogenesis of obesity and insulin resistance.
22824620 The correlation observed between Caveolin-1 and downstream signaling molecule expression may be an important mechanism of arsenic-induced urothelial carcinogenesis.
22807396 Caveolin-1 suppresses the growth and differentiation of undifferentiated mesenchymal stem cells, and upon cell differentiation caveolin-1 expression is upregulated to stabilize the cell phenotype and reduce cell plasticity and renewal potential.
22772753 Caveolin-1 promotes monocyte to macrophage differentiation through the regulation of EGR-1 transcriptional activity, suggesting that phagocytic caveolin-1 may be critical for atherogenesis.
22748181 Since hypoacetylated p65 has been shown to inhibit transcription, the authors conclude that caveolin-1 inhibits HIV-1 transcription through a NF-kappaB-dependent mechanism.
22745744 caveolin-1 acts as an anti-apoptotic protein in colon cancer cells by binding to Ku70 and inhibiting Bax-dependent cell death.
22730441 In healthy humans, increases in leptin, as seen with modest weight gain, may increase caveolin-1 expression in adipose tissue; increased caveolin-1 expression in turn impairs leptin signaling.
22706202 Data show that elevated CAV1 upregulates glucose uptake and ATP production through HMGA1-mediated GLUT3 transcription, suggesting that CAV1 may render tumor cells growth advantages by enhancing aerobic glycolysis.
22693251 complex formation between the DLC1 START domain and CAV-1 contributes to DLC1 tumor suppression via a RhoGAP-independent mechanism, and suggest that DLC1 inactivation probably contributes to cancer progression.
22674854 Overexpression of caveolin 1 in HM-7 cells down-regulate proliferation, viability, wound closure, adhesion to laminin, invasion, and development of filopodial and lamellipodial structures in a dose-dependent manner.
22659071 the human CAV1 upstream purine complex modifies gene expression
22593443 confirmed that depletion of CAV1 rendered anoikis-resistant H_AR2 cells sensitive to anoikis
22575653 Caveolin1 acts upon EGF endosomes internalized via the Clathrin-pathway and functions at the transition from early to late endosomes.
22571278 The research reports a novel role for calveolin-1 in tumour-induced immunosuppression during the progression of chronic lymphocytic leukaemia.
22564243 CAV-1 affected cell growth of lung cancer NCI-H446 cell through the interactions with p-ERK1/2, estrogen receptor and progestin receptor
22547813 Perturbation of Ca(V)1.1 negative regulation of RyR1 leak identifies a unique mechanism that can sensitize muscle cells to malignant hypothermia triggers.
22547061 Cav-1 inhibits cellular antioxidant capacity through direct interaction with Nrf2 and subsequent suppression of its activity
22528500 Caveolin-1 and dynamin-2 are essential for removal of the complement C5b-9 complex via endocytosis.
22513979 Gal3 and Cav1 therefore function synergistically to promote focal adhesion signalling, migration and progression of differentiated thyroid cancer.
22506673 point mutations at position 132 of Cav1(62-178) revealed that no other hydrophobic amino acid can preserve the monomeric state of Cav1(62-178), indicating that proline 132 is critical in supporting proper caveolin-1 behavior.
22502704 Promoter hypermethylation and loss of expression of the CAV-1 gene is associated with breast cancer.
22474227 A frameshift mutation in caveolin-1 (CAV1)is identified, which encodes a membrane protein of caveolae abundant in the endothelium and other cells of the lung.
22474125 Data suggest that Cav1 is down-regulated in 95% of tumor specimens from patients with Barrett adenocarcinoma; strong cytoplasmic expression of Cav1 correlates with poor disease-free survival in small subgroup of patients.
22454521 Actin, microtubules and Abl tyrosine kinases regulate Cav1 inward trafficking.
22433870 novel roles for CAV1 variants in cell death; wtCAV1 promotes cell death, whereas CAV1beta promotes cell survival by preventing inactivation of BCL2 and BCLxL via JNK in paclitaxel-mediated apoptosis.
22411794 CAV1 is a direct transcriptional target of oxygen-labile hypoxia-inducible factor 1 and 2 that accentuates the formation of caveolae, leading to increased dimerization of EGF receptor.
22402147 These results add CAV1 to the list of systemic sclerosis susceptibility genes and provide further evidence for the contribution of this pathway in the fibrotic process that characterises pathogenesis.
22395498 nestin and caveolin-1 could have a role in GISTs, together with CD117 and CD34
22378247 results suggest expression of Cav-1 in the tumour cells, rather than in the stromal tissue surrounding the tumour, may promote cervical squamous cell carcinoma cell proliferation, and correlates with high-risk HPV infection
22370641 WNT6 and Cav1 are upregulated by chemotherapeutics and enhance the resistance of GC cells to anthracycline drugs
22353809 We hypothesise that it is the activity of Src that drives the relationship with Cav-1 and RhoGD12 expression in transition cell carcinoma of the bladder
22353223 This review presents the current understanding of their function and the involvement of caveolin-1 in breast cancer pathogenesis. [review]
22323292 activation of eNOS promotes Src-dependent Cav-1-Tyr-14 phosphorylation and eNOS/Cav-1 binding, that is, eNOS feedback inhibition
22316086 These data support that C. neoformans internalization into HBMEC is a lipid raft/caveolae-dependent endocytic process where the actin cytoskeleton is involved, and the Cav1 plays an essential role in C. neoformans traversal of the blood-brain barrier.
22287735 A novel role of Cav-1 protein is the suppression of cellular oxidative stress induced by hydrogen peroxide in lung carcinoma.
22277751 our results indicate a novel role of Cav-1 in anoikis regulation through Mcl-1 interaction and stabilization
22277251 Systemic sclerosis fibroblasts with constitutive Smad1 phosphorylation have elevated cav-1 expression.
22241747 Cav-1 is an important regulator of store-operated Ca(2+) entry in human airway smooth muscle by influencing plasma membrane sarcoplasmic reticulum interactions.
22240009 The transmembrane domain of caveolin-1 exhibits a helix-break-helix structure.
22238363 caveolin-1 normally traffics to and from the cytoplasmic surface of lysosomes during intracellular cholesterol trafficking.
22236542 Stromal caveolin-1 expression were more frequent in anaplastic carcinoma and diffuse sclerosing variant of papillary carcinoma compared to conventional papillary thyroid carcinoma.
22215724 Activated CD47 promotes pulmonary arterial hypertension through targeting caveolin-1.
22201996 Alterations of TES mRNA level may predict the location of metastasis. CAV1 possibly affect the cancer cell invasion
22200856 Higher Cav1 expression correlated with the advanced pathological stage and shorter survival rates in lung adenocarcinoma patients.
22194465 Findings defined Cav-1 as an important downstream oncogenic target of FoxM1, suggesting that dysregulated signaling of this novel FoxM1-Cav-1 pathway promotes pancreatic cancer development and progression.
22159333 Insignificant differences in Cav-1 between the sera of patients and controls (5.69 in the cancer group vs. 5.42 ng/ml in the control group).
22152020 Over expression of caveolin-1 in the tumour cell cytoplasm predicts a poor prognosis of patients with clear cell RCC.
22142403 Membrane binding CAV1 key fragments are involved in multiple critical functions that include protein recognition, oligomerization, and cholesterol binding consistent with the role for CAV1 scaffolding domain.
22134245 High expression of stromal Cav-1 correlates with longer survival in malignant melanoma metastases, and high expression of Cav-1 in melanoma cells correlates with longer survival in primary malignant melanoma.
22128235 Phosphorylation of Tyrosine 14 in CAV-1 and transcriptional regulation of CAV-1 expression may have a role in glaucomatous alterations in trabecular meshwork cells of patients with primary open angle glaucoma.
22127416 SorLA and caveolin-1 directly or indirectly interact in glia and share subcellular distribution patterns.
22095627 The interaction of LC3B and Fas pathways requires cav-1.
22075971 loss of CAV1 mRNA expression may play a role in prostate cancer progression.
22072235 Caveolin-1 overexpression is associated with hepatocellular carcinoma tumourigenesis and metastasis.
22057638 Loss of stromal caveolin-1 is associated with early tumor recurrence.
22041584 Cav-1 functions as a crucial modulator of epithelial-mesenchymal transition and cell differentiation in pancreatic cancer.
22038047 sensitivity of non-small-cell lung cancer cells to metformin was dependent on Cav-1 expression
21976276 Arterial remodeling was associated with number of G alleles of CAV-1 polymorphism, GG homozygotes displaying intimal-media thickness and carotid cross-sectional area that were, respectively, 16% and 21% higher than those in patients without risk allele
21965789 The aim of this study was to evaluate the association between nasopharyngeal carcinoma susceptibility and Cav-1 genotypes.
21965771 The association of the potential risk haplotype agrees well with a role of CAV1 genotype in breast cancer risk and the association with tumor progression needs further investigation.
21951852 The results suggest that the region of caveolin-1 between amino acids 62 and 100 is an oligomerization domain as well as an attachment site for ABCA1 interaction that regulates HDL-mediated cholesterol efflux.
21949119 a role for gangliosides in regulating tumor cell motility by affecting the function of a signaling complex organized by caveolin-1
21925842 Study reveals an important role for cav-1 as a negative regulator of MMP-1 gene expression via inhibition of Erk1/2/Ets1 signaling in dermal fibroblasts.
21918362 Caveolin-1 knockdown by small interfering RNA reduces H2O2-induced SHP-2 phosphorylation in rat primary astrocytes and in CRT-MG human astroglioma cells.
21909981 This study does not corroborate the reported frequent occurrence of CAV1 gene mutations, including CAV1 (P132L), in primary human breast carcinomas.
21901744 caveolin-1 controls alpha(5) beta(1) integrin expression through the TGF-beta/TGF-betaRI/Smad2 pathway in glioblastoma
21882259 Cx43 controls the tumor phenotype of glioblastoma U251 cells and in particular, invasion capacity, through its localization in lipid rafts containing CAV1.
21873608 The identified single nucleotide polymorphisms are associated with primary open-angle glaucoma in the Caucasian US population and that specific haplotypes located in the CAV1/CAV2 intergenic region are associated with the disease.
21861625 alpha7 nicotinic acetylcholine receptor-mediated signaling through caveolin-1-enriched lipid rafts/caveolae is required for nicotine-enhanced Escherichia coli K1 invasion of human brain microvascular endothelial cells.
21841821 these data are consistent with the possibility that accumulation of truncated Dsg2 protein interferes with desmosome assembly and/or maintenance to disrupt cell-cell adhesion.
21840940 our results indicate that ERK1/2, Akt, and cav-1 are involved in the regulatory mechanisms of PPAR-mediated protection against HIV-1-induced MMP-9 expression in brain endothelial cells
21822278 Data show that expression of VCP mutant proteins, or siRNA-mediated depletion of UBXD1 leads to a block of CAV1 transport at the limiting membrane of enlarged endosomes in cultured cells.
21804187 Data show that F92A-Caveolin-1 and a mutant cell-permeable scaffolding domain peptide called Cavnoxin can increase basal NO release in eNOS-expressing cells.
21803870 Caveolin-1 plays an important role in airway inflammation by modulating the effect of specific cytokines on intracellular calcium[Ca(2+)].
21789897 subjects who had GG/AT or GG/AA at Cav-1 G14713A/T29107A showed a decreased risk of bladder cancer compared to subjects with GG/TT, while those of any other combinations were of increased risk.
21761200 These findings reveal novel aspects regarding role of Cav-1 in modulating oxidative stress induced by cisplatin.
21729786 Stroma associated with human carcinomas and melanoma metastases is enriched in Cav1-expressing carcinoma-associated fibroblasts (CAFs).
21715681 This study showed that Toll-like receptor 4 (TLR4) and caveolin-1 are binding partners in chondrocytes; their expression is temporally regulated by fluid shear via the sequential up-regulation of microsomal PGE synthase-1 and L-PGDS.
21704113 HIV-1 Nef induces phosphorylation of CAV1 in endothelial cells
21690289 Cav1 cooperated with the endogenous Ras/MAPK inhibitor Dok1 to promote the ligand-dependent transcriptional activity of PPARgamma and to inhibit cell proliferation
21683457 Six overlapping haplotypes of caveolin 1 gene purine complex are detected in multiple sclerosis and Alzheimer's disease patients.
21613355 Variations in the CAV1 gene are associated with insulin resistance and hypertension.
21611203 IGF1R internalization and co-localization with clathrin and CAV1 upon ligand binding, as well as the status of the IGF1R pathway, cellular proliferation, and the apoptosis of interfered and inhibited Ewing's sarcoma, were analyzed.
21609392 Skeletal muscle telocytes (TCs) express c-kit, caveolin-1 and secrete VEGF. In culture, TCs (but not satellite cells) emerge from muscle explants and form networks suggesting a key role in muscle regeneration and repair, at least after trauma.
21585620 high Cav-1 expression in tumor cells and lack of this expression in stromal cells could help identify a particular subgroup of breast cancer patients with potentially poor survival.
21584795 the loss of stromal caveolin-1 is related to poor prognosis in invasive ductal carcinoma
21551225 CAV2 mRNA and protein levels are reduced by both NFBD1 knockdown and knockout independently of IR and p53
21521946 identify and characterize the signaling pathways that are activated in Cav-1 negative tumor stroma using gene expression profiling
21514437 GATA-6 acts as a transcriptional repressor of CAV1 gene expression in partial bladder outlet obstruction-induced bladder wall smooth muscle hypertrophy
21473727 This is the first study to show that CAV1 mRNA expression is significantly higher in renal cell cancer compared with normal renal tissue.
21471610 This review is focused on the role of caveolin-1 in several soft tissue and bone sarcomas and discusses the use of this protein as a potential diagnostic and prognostic marker and as a therapeutic target.
21445970 Melanoma cells show remarkable resistance to Cav-1 disassembly, together with persisting cell signal activity, being Src and Cav-1 crucial modulators of Rho GTPases.
21440420 Caveolin 1 inhibits transforming growth factor-beta1 activity via inhibition of Smad signaling by hypertrophic scar derived fibroblasts in vi
21430048 In the presence of Cav-1, phosphorylation of IKKbeta, IKKalpha, IkappaBalpha, and NF-kappaB p65 is dramatically reduced, while HIV-1 viral gene expression is suppressed.
21416157 caveolin-1 overexpression is associated with hepatocellular cancer.
21378366 Study provides evidence for the relationship of this variant of CAV1 and risk of prostate cancer which might merit further study as a genomic marker for early detection of prostate cancer.
21373757 secreted CAV1 may also contribute to the malignant properties of Ewing's sarcoma.
21372166 Dynamic movement of cav-1 is essential for physiological contractile response of colonic smooth muscle.
21340433 CaR and Cav-1 co-localize on the plasma membrane in HUVECs and CaR-induced Ca(2+) influx is down-regulated by binding with Cav-1.
21335944 Caveolin-1 may participate in the pathogenesis of bladder pain syndrome/ interstitial cystitis
21321670 data and observations imply that a primary open angle glaucoma (POAG) risk allele at the 7q31 locus that contains the caveolin genes CAV1 and CAV2 is not strongly associated with glaucoma in an Iowa population
21302621 Findings indicated a reduction of caveolin- 1 expression in NSCLC and suggested that caveolin-1 as well as VEGF-C might be involved in lymph node metastasis of NSCLC.
21246406 Cav-1 polymorphisms are associated with oral cancer.
21199324 study identifies a new function for caveolin-1 in controlling smooth muscle phenotype; this mechanism could contribute to allergic asthma.
21165568 Cav-1 immunoreactivity in lung cancer is histotype-dependent, increased Cav-1 expression indicates the malignant progression and high invasion features of non-small cell lung carcinomas.
21152401 Findings suggest that Cav-1 and PTRF/Cavin could represent two relevant and distinct targets to modulate IGF-IR function.
21148404 Caveolin-1 plays a key role as a negative regulator of anoikis through a reactive oxygen species-dependent mechanism in human lung carcinoma H460 cells.
21133631 We conclude that the gene encoding CAV-1 plays an important role in the promotion of mammary tumorigenesis in Kashmir.
21109942 miR-133a is directly bound to CAV1 mRNA. Cancer cell migration and invasion were significantly inhibited in HNSCC cells transfected with si-CAV1. Therefore, CAV1 functions as an oncogene in HNSCC.
21106507 the molecular mechanisms by which CAV1 carries out its key role in regulating ESFT metastasis involve matrix metalloproteinase production and activation as well as the control of the expression of SPARC, a known determinant of lung colonization.
21098633 These results highlight a crucial role for caveolin-1 in negative regulation of membrane microdomain mobility, thereby affecting endocytosis of bacteria-engaged integrins.
21074769 Identify leptin mediated proatherogenic mechanism and a novel caveolin-1 dependent leptin feedback mechanism which may have implications for development of peripheral leptin resistance in the endothelium.
21041450 The CAV1 became detectable in late endosomes (LE) and lysosomes where it was degraded.
21039037 Mutations in Caveolin-1 is associated with breast tumorigenesis.
20977883 caveolin-1 could suppress TrkA-mediated pleiotypic effects by altering TrkA modification via functional interaction.
20940300 pCav-1 is a new substrate of TCPTP and that integrin alpha1beta1 acts as a negative regulator of Cav-1 phosphorylation by activating TCPTP.
20923773 reactive oxygen species and caveolin-1 have roles in lung cancer cell migration and invasion
20881564 This study demonistrated in patient with sporadic vestibular schwannomas down-regulation of CAV1 at both the mRNA and protein levels.
20855565 Observational study of gene-disease association. (HuGE Navigator)
20842066 Regulator of G-protein signaling RGS-14 may prevent higher calcium ion (Ca2+) into the cytoplasm by reducing Ca2+ influx through Cav1 channels.
20835266 Caveolin-1 may regulate the expression of LOX-1 and ox-LDL uptake.
20835238 Single Nucleotide Polymorphisms in CAV1 is associated with primary open-angle glaucoma.
20835238 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20819778 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20819483 Positive expression of caveolin-1 in bladder transitional cell carcinoma can be regarded as a high risk factor of recurrence.
20810358 This review provides new insights concerning the modulation of vascular smooth muscle ATP-sensitive K+ channels (KATP) channel gating by CAV1 that may have important implications for the control of diameter and blood flow in health and disease.
20736308 Beta-Dystroglycan interaction with caveolin-1 in smooth muscle is required for receptor-mediated Ca2+ release.
20729193 the single Pro residue in the membrane-inserting segment of caveolin-1 plays an important role in both the membrane topology and localization of the protein as well as its functions
20700465 Cav-1 may play a critical role in sensing genotoxic stress and in orchestrating the response of cells to DNA damage
20646460 TGF-beta(1) reduced caveolin-1 mRNA and protein expressions in a dose- and time-dependent manner in fetal lung fibroblasts.
20629037 SR-BI, CD36, and caveolin-1 contribute positively to cholesterol efflux in hepatic cells.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20624795 Interaction of caveolin-1 functionally regulates the activity of the vascular subtype of K(ATP) potassium channel Kir6.1 in rat aortic smooth muscle cells.
20610713 These results suggest that HIV infection enhances the expression of Cav-1 mediated by HIV Tat, which subsequently causes virus reduction, suggesting that Cav-1 may contribute to persistent infection in macrophages.
20610713 HIV-1 Nef induces phosphorylation of CAV1 in endothelial cells
20605793 Overexpression of Cav1 accelerated internalization of mature hERG channels in 0 mM K(+)(o), whereas knockdown of Cav1 impeded this process.
20581046 These results raise doubt about the presence of the caveolin-1 P132L mutation in breast cancer and other cancer types, and thus further studies are warranted
20558341 QDs-IHC could accurately detect protein location in tongue mucosa. An increased expression of Cav-1 in the stepwise carcinogenesis from NTM, HTM, TPL to PTSCC suggested that Cav-1 might be an oncogene in the development of tongue squamous cell carcinoma.
20543983 Messenger RNA and protein levels of Cav1 were increased in AM with silenced CFTR
20463894 Caveolin-1 regulates BeWo cell differentiation and fusion, possibly through a mechanism involving modulation of Akt activity.
20427576 These data demonstrate a new function for PTRF/cavin-1, a new functional interaction between caveolin-1 and Rab8 and that actomyosin interactions can induce tension on caveolin-1-containing membranes.
20411337 down-regulation of caveolin-1 protein expression leads to deregulate estrogen receptor alpha (ERalpha) signaling and consequently early transformation in mammary epithelia
20395445 Data demonstrate that caveolin-1 expression is a determinant of membrane PTEN levels and show that PTEN interacts with caveolin-1 via its caveolin-1-binding sequence.
20392844 The authors examine the interaction of cellular Cav-1 and HIV gp41 within the lipid rafts and show that Cav-1 modulates Env-induced bystander apoptosis through interactions with gp41 in SupT1 cells and CD4(+) T lymphocytes.
20392844 HIV-1 Nef induces phosphorylation of CAV1 in endothelial cells
20374325 angiogenic growth factors downregulated IL-1beta-induced chondrocyte ageing and overexpression of caveolin-1 in human chondrocytes
20371787 Among kidney transplant donors, the CAV1 rs4730751 SNP was significantly associated with allograft failure in 2 independent cohorts
20371787 Observational study of gene-disease association. (HuGE Navigator)
20346360 Observational study of gene-disease association. (HuGE Navigator)
20345844 Decreased Cav-1 expression in fibrotic diseases likely leads to increased deposition of IGFBP-5 in the extracellular matrix.
20209490 We found modest evidence for an association with a variant in the cav-1 gene and risk of overall prostate cancer and aggressive prostate cancer
20209490 Observational study of gene-disease association. (HuGE Navigator)
20187291 caveolin-1 silencing induces concomitant decrease of TRPC1 expression and reduces oxLDL-induced apoptosis of VSMC
20153318 Matrix invasion and cell migration as well as expression of matrix metalloproteases were attenuated following caveolin-1 RNAi-mediated knockdown or overexpression of Y14F and P132L mutants, demonstrating dominant-negative activity of these mutants.
20127227 Functional assays demonstrated enhanced early proliferation by CAV1 expression in TK6 cells after irradiation with clinically relevant doses supporting the role of CAV1 as a prosurvival factor.
20062063 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20062060 Meta-analysis and genome-wide association study of gene-disease association. (HuGE Navigator)
20031158 could inhibit pancreatic carcinoma cell invasion, at least in part, probably through Erk-MMP signal pathway
20021823 Over-expression of caveolin-1 inhibits the growth and invasion of pancreatic carcinoma cells in vitro.
19965594 Caveolin-deficient adipocytes can form only small lipid droplets, suggesting that the caveolin-lipid droplet pool might be involved in lipid droplet size regulation.
19960513 RNAi knockdown of Cav-1 increased COX-2 protein level and decreased ubiquitinated COX-2 accumulation.
19948975 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and genetic testing. (HuGE Navigator)
19930645 Disruption of the caveolin-binding site interferes with the cav-1/maxi-K channel interaction, and lack of the cav-1/maxi-K channel interaction in MSMCs attenuates the total K+ channel current of the cell.
19913121 Observational study of gene-disease association. (HuGE Navigator)
19897728 Results suggest that activation of TRPC1-SOC by STIM1 mediates release of the channel from caveolin-1.
19893453 Data show that the activities of EGFR-MAPK signal pathway were inhibited significantly by overexpression of cav1.
19887621 Cav-1 is an essential regulator of MT1-MMP function and invadopodia-mediated breast cancer cell invasion
19846513 that HBV requires a Cav-1-mediated entry pathway to initiate productive infection in HepaRG cells
19828204 Our data highlight the CAV1 upstream purine complex as a novel susceptibility genomic locus in the pathophysiology of MS. The region has been conserved across species, including mouse, guinea pig, rhesus macaque, and human.
19828204 Observational study of gene-disease association. (HuGE Navigator)
19820694 Caveolin 1 expression inhibits TrxR1-mediated cell transformation.
19816600 The relationship between caveolin-1 and apoptosis of lens epithelial cell under high glucose, was investigated.
19801678 Data show that Nox2 and IL-1R1 localize to plasma membrane lipid rafts in the unstimulated state and that IL-1beta signals caveolin-1-dependent endocytosis of both proteins into the redoxosome.
19787257 a combination of COX-2 and HMG-R inhibitors synergistically inhibits caveolin-1 and its associated signaling pathways
19767411 Deletion of cav-1 protects hyperoxia-induced apoptosis via modulation of survivin expression.
19759399 GM3 synthase overexpression results in reduced cell motility and in caveolin-1 upregulation in human ovarian carcinoma cells
19718715 might increase small cell lung cancer metastasis potential through the interaction with E-cadherin and MMP-3 genes
19718657 caveolin-1 in hepatic cells increases oxidized LDL uptake and preserves the expression of lipoprotein receptors CD36 and SR-BI
19716156 caveolin-1 is not useful as diagnostic marker to differentiate grade II astrocytomas from oligodendrogliomas.
19706615 These findings indicate a novel pathway for nitric oxide regulation of caveolin-1, which could be a key mechanism of anoikis resistance in tumor cells.
19692168 Observational study of gene-disease association. (HuGE Navigator)
19679565 Data show low or moderate methylation was found in seven selected genes BAD, BBC3, CAV1, CDK2AP1, NPM1, PRKCDBP and THEM4.
19641024 Data show that caveolin-1 and E-cadherin closely associated at cell borders and in internalized structures upon stimulation with EGF.
19625176 Observational study of gene-disease association. (HuGE Navigator)
19620302 A potential binding site for caveolin-1 is present in the platelet-activating factor receptor (PAFR) sequence; many downstream signaling components of PAFR activation preferentially localize in caveolae.
19614763 Cav-1 immunoreactivity in lung carcinoma is histotype-dependent and acquired de novo in brain metastases, suggesting a site-specific phenotypic shift in secondary lesions.
19614762 Cav-1 is a novel immunohistochemical marker for the differentiation of epithelioid mesothelioma from lung adenocarcinoma.
19609943 Data imply that targeting CAV1 and/or PKCalpha may allow the development of new molecular therapeutic strategies to improve the treatment outcome for patients with ESFT.
19582878 Upregulation of caveolin-1 expression is associated with nasopharyngeal carcinoma.
19581923 Serum cav-1 levels were higher in prostate cancer patients than in control men without prostate cancer, and the preoperative serum cav-1 concentration had prognostic potential in men undergoing radical prostatectomy[review]
19556867 loss of stromal Cav-1 is predictive of elevated levels of epithelial Cav-1 and epithelial Akt-activation and is associated with advanced prostate cancer.
19521982 Wild-type Cav-1, but not mutated Cav-1Y14A, increased tumorigenicity as indicated by enhanced proliferation, migration, invasion and capacity of forming foci in semisolid medium. Accordingly, Cav-1 silencing inhibited melanoma cell growth.
19499152 results revealed that the interaction between IFITM1 and CAV-1 could enhance the inhibitory effect of CAV-1 on ERK activation
19494002 HPV16 infection is dependent on caveolin-1 after clathrin-mediated endocytosis.
19487814 loss of caveolin-1 leads to hyperactive eNOS and subsequent tyrosine nitration-dependent impairment of PKG activity, which results in pulmonary hypertension.
19483462 Caveolin-1 overexpression in the MCF-7 breast cancer cell line modulates EGFR activation levels and EGF-induced EGFR signalling.
19483189 Increased caveolin 1 is associated with metastatic lymph node sites in non-small-cell lung cancer.
19477952 Caveolin-1 and caveolae play a paradoxical role in regulating VEGF-induced ERK2/1 activation and in vitro angiogenesis
19475601 findings elucidate novel predisposing haplotypes at the CAV1 gene purine complex, and confirm the role of this region in the etiopathophysiology of late-onset Alzheimer disease
19475601 Observational study of gene-disease association. (HuGE Navigator)
19434519 caveolin-1 may play an important role in the progression of hepatocellular carcinoma and angiogenesis.
19411449 stromal caveolin-1 expression may be a potential therapeutic target and a valuable prognostic indicator of breast cancer progression.
19411448 Cav-1 functions as a tumor suppressor in the stromal microenvironment.
19395651 Cav-1(P132L) mutation is associated with metastasis in breast cancer.
19386787 Data show that efficient initiation of innate immunity to P. aeruginosa requires formation of an epithelial "internalization platform" involving both caveolin-1 and functional, laterally mobile CFTR.
19381331 Exotest for CD63+ plasma exosomes had limited sensitivity but the Exotest for detection of caveolin-1+ plasma exosomes showed a higher sensitivity. Caveolin-1+ plasma exosomes were significantly increased with respect to CD63+ exosomes in patients group
19369293 These results indicate that lipid rafts/caveolae participate in UT-A1 membrane regulation and this effect is mediated via a direct interaction of caveolin-1 with UT-A1.
19342880 Immunostaining of Cav-1 can be used as a first step to stratify human breast cancer patients and to predict the presence of Cav-1 mutations.
19288272 This work defines a novel role for caveolin-1 with implications for the clinical course of breast cancer and identifies caveolin-1 as a potential drug target for the treatment of early oestrogen-dependent breast cancers
19286607 Akt-mediated transactivation of the S1P1 receptor in caveolin-enriched microdomains regulates endothelial barrier enhancement by oxidized phospholipids.
19250636 These data demonstrate that IGF-IR/integrin beta1 cross talk is followed by integrin beta1 lipid raft compartmentalization and that Cav-1 is required for this process.
19244345 By reducing COX-2 expression, caveolin-1 interrupts a feedback amplification loop involving PGE(2)-induced signaling events linked to beta-catenin/Tcf/Lef-dependent transcription of tumor survival genes including cox-2 itself and survivin.
19234134 CAV1 deficient mammary stromal fiboblasts are able to undergo endothelial-like transdifferentiation, and are predictive of poor outcome in breast cancer.
19219452 Cav-1, increased after the 1,500 m swim trial in vastus lateralis .
19170196 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19160064 Data show that Cav-1 expression in tumor tissues was correlated with both the Ki-67 and p53 expression.
19123976 caveolin-1 is essential in the down-regulation of MT1-MMP activity by promoting internalization from the cell surface
19121286 These data suggest that flotillin-1 regulates caveolin-1 level by preventing its lysosomal degradation in intestinal epithelial cells.
19116988 In prostate cancer cells in culture, delta-catenin was co-localized with caveolin-1 and CD59, suggesting its potential excretion into extracellular milieu through exosome/prostasome associated pathways.
19104007 GTPCH I is targeted to caveolae microdomains in vascular endothelial cells, and tetrahydrobiopterin production occurs in proximity to endothelial NO synthase. The regulation of GTPCH I activity involves the caveolar coat protein, caveolin-1.
19061949 The data suggested that autophagy played a key role in Cd2+ induced endothelial dysfunction; integrin beta4, caveolin-1 and PC-PLC might be the targets of Cd2+ in vascular endothelial cells.
19059381 hepaCAM is partially localized in the lipid rafts/caveolae and interacts with Cav-1 through its first immunoglobulin domain.
19052258 Caveolin-1 scaffold domain interacts with TRPC1 and IP3R3 to regulate Ca2+ store release-induced Ca2+ entry in endothelial cells.
19038362 Reviews recent studies in adipocytes, the specialized cell type for fatty acid storage, which suggest a role for caveolins in the formation, maintenance or mobilization of lipid droplet stores.
19032226 Caveolin-1 expression is a distinct feature of chronic rejection-induced transplant capillaropathy.
19015640 Caveolin-1 was upregulated and beta-catenin was recruited to the plasma membrane when xCT was deficient, which were followed by the inhibition of beta-catenin transcriptional activity.
19010547 HIV-1 Nef induces phosphorylation of CAV1 in endothelial cells
19002697 Caveolin-1 is the membrane protein that forms part of the caveolae.The main functions of caveolae are transcytosis of both large and small molecules across cell membrane.
19002186 In head and neck squamous cell carcinoma, cav-1 may play an inhibitory role in tumorigenesis and lung metastasis through regulating integrin beta1- and Src-mediated cell-cell and cell-matrix interactions.
18992712 These results reveal a new mechanism by which caveolin-1 negatively regulates TRAIL-induced apoptosis in human hepatocarcinoma cells.
18992284 The phenotypic changes observed after caveolin-1 modulation were mediated by alpha(5)beta(1) integrins.
18985008 Findings suggest that hOAT4 and caveolin-1 share a cellular expression in the plasma membrane and caveolin-1 up-regulates the organic anionic compound uptake by hOAT4 under the normal physiological condition.
18957516 Caveolin-1 plays a dual role in the fibronectin assembly regulated by uPAR signaling.
18936967 Absence of significant correlations between cav-1 expression and other pathological parameters, such as the stage of disease or the patients overall survival, indicates that the role of cav-1 in GC is neither stage-specific nor related to prognosis.
18923542 Data indicate that HERG channels interact with caveolin-1 and are negatively regulated by this interaction.
18922892 a feedback loop between Rho/ROCK, Src, and phosphorylated Cav1 in tumor cell protrusions, identifying a novel function for Cav1 in tumor metastasis that may contribute to the poor prognosis of some Cav1-expressing tumors.
18836420 variations of caveolin-1 expression may have an important role in the progression of human breast lobular cancer
18802406 Co-expression of fatty acid synthase and caveolin-1 in pancreatic ductal adenocarcinoma.
18793348 caveolin-1 is expressed in cardiac myocytes, localized to both caveolae and non-caveolar domains in the plasma membrane
18789131 irradiation triggered caveolin-1 dependent Receptor, Epidermal Growth Factor internalization into caveolae.
18759267 Caveolin 1 appears to participate in the pathogenesis of tissue fibrosis in systemic sclerosis.
18698612 A new subtype of congenital generalized lipodystrophy is not associated with the CAV1 gene.
18681962 There is a role for caveolin-1 in degenerative rather than age-induced changes in the nucleus pulposus. A positive correlation was identified between gene expression of caveolin-1 and p16INK4a (biomarker of cellular senescence).
18676680 Observational study of gene-disease association. (HuGE Navigator)
18667611 Caveolin-1 may provide an effective target to protect against human immunodeficiency virus-1 (HIV-1) protein Tat-induced brain microvascular endothelial cell dysfunction and disruption of the blood-brain barrier in HIV-1-infected patients.
18667611 HIV-1 Nef induces phosphorylation of CAV1 in endothelial cells
18667513 Caveolin-1-dependent infectious entry of human papillomavirus type 31 in human keratinocytes proceeds to the endosomal pathway for pH-dependent uncoating
18635971 These findings suggest that FASN and Cav-1 physically and functionally interact in PCa cells.
18598695 These data indicate that caveolin-1 specifies filamin A as a novel target for Akt-mediated filamin A Ser-2152 phosphorylation thus mediating the effects of caveolin-1 on IGF-I-induced cancer cell migration.
18596970 the relationships between Cav-1 abundance, atherosclerotic plaque characteristics and clinical manisfestations of atherosclerotic disease.
18561140 We report a novel polymorphic purine complex stretching approximately 150 bp of genomic DNA at the 1.5 kb upstream region of the human CAV1 gene, alleles and genotypes of which are associated with sporadic late-onset Alzheimer's disease.
18561140 Observational study of gene-disease association. (HuGE Navigator)
18543249 Concluded that IL-6/sIL-6R enhances cathepsin B and L production via IL-6/sIL-6R-mediated Cav-1-JNK-AP-1 pathway in human gingival fibroblasts.
18510854 Growth and proliferation related Akt and Erk1/2 pathways were inhibited after caveolin-1 down-regulation.
18458534 Human breast cancer-associated fibroblasts show CAV1 down-regulation and RB tumor suppressor functional inactivation.
18444242 Wild-type APC regulates CAV1 expression in human colon adenocarcinoma cell lines via FOXO1a and C-myc.
18439424 This is the first evidence of increased nuclear and cytoplasmic localization of caveolin 1 during establishment of H(2)O(2)-induced premature senescence.
18437015 caveolin-1 may play an important role in the progression of transitional cell carcinoma of the upper urinary tract
18434090 Cav-1 increases the basal and TGF-beta1-induced expression of type I procollagen by regulating two opposite signaling pathways: inhibiting TGF-beta1/smad signaling and activating a PI-3 kinase/Akt/mTOR-dependent pathway in human dermal fibroblasts.
18406871 Downregulation of CAV1 is associated with primary prostate carcinoma
18332144 focal adhesion kinase mediates caveolin-1 up-regulation during epithelial to mesenchymal transition
18312604 Androgen dependent prostate growth in benign prostate hyperplasia may be linked to the interaction of androgen binding protein and oxytocin receptor, associated with caveolin 1
18308897 Caveolin mediates rapid glucocorticoid effects and couples glucocorticoid action to the antiproliferative program.
18301242 a novel and unexpected pattern of Cav-1 expression in human skeletal muscle suggests a role for Cav-1 in terminal differentiation processes
18300018 caveolin-1 plays a tumor-promoting role in advanced-stage cancer. (review]
18296864 Alteration of store-operated Ca(2+) entry by caveolin-1 expression changes could be one of the mechanisms contributing to the progression of breast cancer.
18282163 an association between cav-1 expression and neoangiogenesis in meningiomas
18258603 Interactions of acetylcholinesterase with caveolin-1 and subsequently with cytochrome c appear to be indispensable for apoptosome formation in a colon cancer cell line.
18245088 AnxA6 interferes with caveolin transport through the inhibition of cPLA(2).
18237401 Very rare CAV1 frameshift mutations appear to be associated with atypical lipodystrophy and hypertriglyceridemia.
18211975 CAV1 as a new Berardinelli-Seip congenital lipodystrophy (BSCL)-related gene and support a critical role for caveolins in human adipocyte function.
18203815 low caveolin-1 levels in fibrotic lungs in scleroderma cause their overexpression of collagen, tenascin-C, and alpha actin
18180853 We observed that in the Glu/Asp and Asp/Asp mutant genotypes, the amount of NOS3 associated with Cav-1 was significantly lower.
18162583 The Cx43/Cavs association occurs during exocytic transport, and they clearly indicate that caveolin regulates gap junctional intercellular communication.
18081315 The knockdown of caveolin-1 in endothelial cells decreases caveolin-2 phosphorylation at serine 23 and upregulation of serine 23 phosphorylation depends on caveolin-1-driven targeting to plasma membrane lipid rafts and caveolae.
18065769 Caveolin-1 interacts and cooperates with the transforming growth factor-beta type I receptor ALK1 in endothelial caveolae.
18054388 CBD1 but not CBD2 binds cells and forms large aggregates at the plasma membrane by colocalizing with cytofacial caveolin-1.
18053095 caveolin-1 travels to late endosomes and is replaced by newly synthesized caveolin-1 at the plasma membrane
17952758 caveolin-1(CAV1) was observed in most cells in myomas and in only few cells in controls; CAV1 was localized with oxytocin receptor and sex hormone binding globulin in myomas
17942630 results show that there is a close association of AT(1), AT(2), and ERalpha with Cav-1 in human arterial smooth muscle cells in culture
17936759 Caveolin-1, specifically localized in cholesterol-enriched lipid rafts, appears to regulate constitutive and agonist-stimulated cell surface levels of 5-HT7 receptors via a clathrin-independent mechanism.
17935714 p53 is an indispensable component of cellular signaling system which is regulated by caveolin-1 expression, involving Akt activation and increase in cyclin D1, thereby promoting proliferation of breast cancer cells.
17933968 PCB77 induces eNOS phosphorylation in endothelial cells through a Src/PI3K/Akt-dependent mechanism, regulated by functional caveolin-1.
17906498 Caveolin-1 inhibits the growth of human laryngeal squamous cell carcinoma HEp2 cell line. CAV1 interacts with EGFR and inhibits phosphorylation of EGFR and Erk1/2.
17898556 Caveolin-1 was expressed in the sinusoidal endothelial cells and the smooth muscle cells of the unparied arteries of hepatpcellular carcinoma specimens.
17855368 caveolin-1 is a novel Id-1 binding partner that mediates the function of Id-1 in promoting prostate cancer progression through activation of the Akt pathway leading to cancer cell invasion and resistance to anticancer drug-induced apoptosis
17851687 COX-2 is localized within caveolae compartment and colocalized with CAV-1 protein in lobular intraepithelial neoplasia of the breast.
17850762 Our studies indicate that the conformational changes are probably initiated at the Caveolin-1 binding moti.
17848177 PAR1 localization in the caveolin-enriched membrane microdomain, bound to caveolin-1, represents a crucial requirement for TF induction in endothelial cells.
17803693 Findings show for the first time the upregulation of mRNA CAV-1 expression levels in VAT and SAT of obese NG and obese T2DM patients compared with lean controls, suggesting a role for CAV-1 in obesity and T2DM development.
17786288 The present data suggest that promoter methylation of the 14-3-3 sigma and CAGE-1 genes plays a crucial role during the phenotypical morphogenesis of vesical adenocarcinomas including signet ring cell carcinomas by an epigenetic mechanism.
17785436 Re-expression of E-cadherin in HT29(US) cells restored the ability of caveolin-1 to down-regulate beta-catenin-Tcf/Lef-dependent transcription and survivin expression, as seen in HT29(ATCC) cells.
17713785 These internalization data were highly suggestive of the predominant use of the clathrin-mediated pathway by NK1-R, even though NK1-R tended to reside constitutively in lipid raft/caveolae microdomains.
17707459 These positive correlations provide new evidence for the involvement of prostate cancer cell derived cav-1 in mediating angiogenesis during prostate cancer progression.
17699771 Data suggest that Cav-1 down-modulation might function as a permissive mechanism, which, by unleashing c-Src and Met signaling, enables osteosarcoma cells to invade neighboring tissues.
17671707 Positive staining resulted in shorter survival in patients with esophageal squamous cell carcinoma.
17662641 Downregulation of caveolin-1 expression affects bleomycin-induced cell cycle arrest and subsequent cellular senescence that is driven by p53 and p21.
17626097 HPV type 31 (HPV31) entry and initiation of early infection events require both caveolin 1 and dynamin 2 and occur independently of clathrin-mediated endocytosis.
17615539 The presence of different caveolin isoforms in many cell types of the human retina, is reported.
17609206 EMP2 regulates caveolin-1 transcription and more substantially its protein levels.
17594718 Results indicated that caveolin-1 expression may have potential both as a diagnostic marker in the differential diagnosis of renal tumors and as a therapeutic target, especially for clear-cell renal cell carcinoma.
17556531 Appropriate caveola-membrane organization by caveolin-1 and detection of estrogen receptor beta in the plasma membrane are directly reflected by MAP kinase phosphorylation and consequent vitamin D receptor expression.
17537407 glucocorticoids modulate the expression of caveolin-1 and caveolae biogenesis within alveolar epithelial cells via both transcriptional and translational modifications
17478448 These data suggested that loss of caveolin-1 is associated with abnormal re-epithelialization in lung fibrosis.
17460461 among astroglial tumors cav-1 expression varies in distribution, pattern & intensity specifically according to tumor types & grades
17379346 the rotavirus NSP4 binding site was localized to caveolin-1 residues 2-22 and 161-178, at the amino- and carboxyl-termini, respectively
17359972 These data suggest that in ovarian carcinoma cells cav-1, localized in transcriptionally inactive chromatin, exerts a functional activity mediated, at least in part, by directly binding to sequences of genes involved in proliferation.
17341888 Aberrant methylation of CAV1 is associated with hepatocellular carcinoma
17334644 Observational study of gene-disease association. (HuGE Navigator)
17314510 This review suggests that caveolin-1 plays an essential role in regulating liver regeneration and that it is implicated in regulation of triglyceride accumulation, an essential process that plays a critical role in the regulation of liver regeneration.
17299799 Over-expression of Caveolin-1 was associated with established features of prostate cancer and aggressive PSA recurrence.
17287217 Ligation of CD26 by caveolin-1 recruits a complex, including CD26 and CARMA1, which functions in lymphocyte activation.
17284246 These results suggest that caveolin-1 regulates GD3-mediated malignant signals by altering GD3 distribution and leading edge formation
17272740 role of caveolin-1 in preventing ischemia-reperfusion injury
17245131 Caveolin-1, as a negative regulator of endothelial cell proliferation, may be a potential target for the control of angiogenesis.
17237399 overexpression of caveolin-1 overcame the VEGF-mediated inhibition of adhesion and restored ICAM-1 clustering
17202321 Prolonged stimulation of isolated human thyrocytes by TSH/cAMP/cAMP-dependent protein kinase inhibits caveolin-1 expression.
17200343 Caveolin 1 has a role in progression of a subset of basal-like and metaplastic breast carcinomas
17197700 the Cav-1 scaffolding domain bound significantly to the gp41 expressed in mammalian cells
17197700 HIV-1 Nef induces phosphorylation of CAV1 in endothelial cells
17190831 CAV1 phosphorylation on Tyr-14 increases the induction of apoptosis by taxanes in breast cancer cells.
17179151 activated EGF receptor transiently modulates integrin alpha2 cell surface expression and stimulates integrin alpha2 trafficking via caveolae/raft-mediated endocytosis
17178917 Results indicate a pivotal role for cav-1 in the regulation of extracellular matrix production and suggest a novel therapeutic target for patients with pulmonary fibrosis.
17111160 The role of caveolin-1 as a factor contributing to the severity of the tubulointerstitial process resulting from obstructive nephropathy could be suggested.
17047056 Loss of CAV1 expression inhibited the anchorage-independent growth of EWS cells and markedly reduced the growth of EWS cell-derived tumors in nude mice xenografts, indicating that CAV1 promotes the malignant phenotype in EWS carcinogenesis.
17014845 transcriptional activation of the IGF-IR gene by Cav-1 requires an intact p53 signaling pathway
16979166 Cav-1 induced the cytoplasmic sequestration of BRCA1.
16931572 The interaction of the GLP-1R with caveolin-1 regulates subcellular localization, trafficking, and signaling activity.
16920641 Results describe the expression of caveolin-1 in human fetal tissues during mid and late gestation.
16904002 caveolae and caveolins are integral membrane components in basal and ciliated epithelial cellsin rats, mice, and humans, indicating a crucial role in these cell types; in addition to their physiological role, they may be involved in airway infection
16897435 Breast cancer patients with higher caveolin-1 expression may benefit from ABI-007 therapy.
16877379 the Sprouty/Caveolin-1 interaction modulates signaling in a growth factor- and Sprouty isoform-specific manner
16857240 Inhibits apoptosis and promotes survival signaling in cancer cells.
16850311 Increased immunoexpression of the Cav-1 seems to be associated with the biological aggressiveness of meningiomas, reflecting a worse prognosis.
16822931 Thus, these results demonstrate a crucial role of caveolin-1 scaffolding domain interaction with TRPC1 in regulating Ca2+ influx via SOC.
16820915 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
16820915 CAV1, either alone or together with eNOS alleles, might modify colorectal cancer heritability.
16807357 A ternary complex between NOSTRIN, caveolin-1, and eNOS mediates translocation of eNOS, with important implications for the activity and availability of eNOS in the cell.
16790997 important roles for VCAM-1 and Caveolin- 1 in the regulation of metastatic potential of gastric tumor cells
16723714 Cav-1-deficient mammary acini displayed increased ERalpha levels and enhanced sensitivity toward estrogen-stimulated growth, with specific up-regulation of cyclin D1
16713605 PSMA binds to caveolin-1 and undergoes internalization via a caveolae-dependent mechanism in microvascular endothelial cells
16617096 As such, caveolae and caveolin-1 coordinate PDGF receptor signaling, leading to myocyte proliferation, and inhibit constitutive activity of p42/p44 MAPK to sustain cell quiescence.
16616146 Homocysteine induced impairment of nitric oxide production through through a modulation of Caveolin-1 expression.
16608879 Results suggest that anti-proliferative and pro-apoptotic properties of caveolin-1 may be attributed to reduced survivin expression via a mechanism involving diminished beta-catenin-Tcf/Lef-dependent transcription.
16601841 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
16601841 The 22285 C-22375-22375 del (Cd) haplotype of CAV1 gene, but not the NOS3-CAV1 interaction, is associated with low levels of blood pressure and protects against metabolic syndrome
16601146 Expression of caveolin is sufficient to drive the formation of caveolae in cell lines normally lacking caveolin, such as human colon cancer cells (Caco-2).
16541313 CAV1 has a role in both hereditary and sporadic breast cancer
16501093 interacts with rotavirus NSP4 and contributes to NSP4 intracellular trafficking from the endoplasmic reticulum to the cell surface.
16480767 Cell-cell contact is required for BeWo trophoblasts to exhibit plasmalemmal caveolin-1.
16443388 Two clones of cells expressing caveolin-1 were investigated for their lipoprotein metabolism activity, showing an increase in ldl liprotein degradation and an increase in HDL lipoprotein activity.
16407214 Epidermal growth factor receptor exposed to oxidative stress undergoes Src- and caveolin-1-dependent perinuclear trafficking
16405917 These novel findings provide insight into possible signaling mechanisms of Nf1 and suggest that together Nf1 and Cav-1 may coordinately regulate cell growth and differentiation.
16338968 It is therefore concluded that caveolin-1 facilitates the hypotonicity-induced release of Cl(-), taurine, and ATP.
16332692 EGF-based signaling cascades phosphorylate Cav1 and have roles in caveolae assembly
16328005 aberrant methylation and abnormal protein expression of the caveolin-1-gene is involved in the formation of nonurothelial carcinomas of the urinary bladder
16324201 CAV1 is down-regulated and inversely correlated with HER2 and EGFR expression status in DCIS of the breast.
16263077 structure activity relationship
16251425 data suggest that caveolin-1 expression indirectly promotes cell-cell adhesion in ovarian carcinoma cells by a mechanism involving inhibition of src-related kinases
16244790 Overexpression of caveolin-1 is associated with inflammatory breast cancer
16225848 These results suggest that caveolae could represent an intracellular site that contributes to differentiate IR and IGF-IR activity, and demonstrate the role of caveolin-1 in the eNOS activation by Insulin and IGF-I.
16202996 Caveolin-1 is more expressed in cancer tissues than normal colon and related with Akt-1, not with Epidermal Growth Factor Receptor expression in colorectal cancer tissues, which suggests that signaling for caveolin-1 affects Akt-1 activation.
15969750 Cav-1 expression inhibits ras homolog gene family, member C GTPase activation and subsequent activation of the p38 MAPK pathway in primary pancreatic cancer cells thus restricting migration and invasion
15968725 increased expression of caveolins in proliferating bile ductules in primary biliary cirrhosis may be related to the homeostasis of cholesterol transport in regenerating bile ductules in liver
15958730 unique features of CAV1 phosphorylation on oxidative stress observed implicate an important role of CAV1 in placental endothelial cell biology during pregnancy.
15948133 Observational study of gene-disease association. (HuGE Navigator)
15948133 This is the first report providing evidence for CAV-1 being involved in predisposition to aggressive prostate cancer
15817451 caveolin regulates the inhibition by cell-bound TFPI of the active protease production by the extrinsic pathway of coagulation
15811424 When we overexpressed caveolin-1 in young mesenchymal stem cells, not only insulin signaling but also adipogenic differentiation was significantly suppressed with down-regulated PPARgamma2.
15769846 The downregulation of caveolin-1 in HCT 116 cells inhibited degradation of the extracellular matrix protein collagen IV and the invasion of these cells through Matrigel.
15703204 Actin cytoskeleton is involved as part of a caveolar complex in the regulation of myometrial maxi-K channel function.
15691837 Results demonstrate that a branched signaling pathway involving MEK, ERK, PKCepsilon, PKCalpha, and caveolin-1 regulates collagen expression in normal lung tissue and is perturbed during fibrosis.
15665033 caveolin-1 (CAV-1) functions as a scaffolding protein for phosphofructokinase (PFK)
15657086 Caveolin-1 inhibits the activation of BMP type IA receptor in preformed hetero-oligomer complexes by binding to BMP type II receptor.
15592498 Caveolin-1 in human breast cancer cells enhances matrix-independent cell survival that is mediated by upregulation of IGF-I receptor expression and signaling.
15590415 The caveolin 1 was found in the endothelial cells of 10-week-old human placenta.
15539149 HIV-1 Nef induces phosphorylation of CAV1 in endothelial cells
15531587 identiication of KLF11 as a dominant repressor of calveolin-1 gene
15504729 potential role of caveolin polarity in lamellipod extension and cell migration.
15496150 Overexpression of caveolin-1 in mesangial cells suppresses MAP kinase activation and cell proliferation induced by bFGF and PDGF, two major cytokines in mesangioproliferative nephritis(MN). Caveolin-1 expression vector is potential therapy for MN.
15485672 facile penetration of alpha-HL's beta-barrel might occur through protein-protein interactions with the surrounding 7 alpha-helices of Caveolin-1
15485671 Caveolin-1 clusters at cell-cell contacts after assembly of alpha-hemolysin into heptameric oligomers
15466889 Caveolin-1 and MAL are located on prostasomes secreted by prostate cancer cells
15466865 association of MT1-MMP with phosphorylated caveolin-1 occurs in caveolae membranes and involves the cytoplasmic domain of MT1-MMP
15458387 caveolin-1 expression was increased upon induction or over-expression of FOXO factors at both mRNA and protein levels
15375584 role of aberrant promoter methylation in the regulation of caveolin-1 gene in breast cancer correlated with clinical findings
15353589 results suggest that CD26-caveolin-1 interaction plays a role in the up-regulation of CD86 on TT-loaded monocytes and subsequent engagement with CD28 on T cells, leading to antigen-specific T cell activation
15334058 Caveolin-1 regulates primary breast tumor growth and spontaneous metastasis of breast cancer.
15314095 a functional peroxisome proliferator response element in the cav-1 promoter is activated upon rosiglitazone treatment in THP-1 macrophages
15274335 Aberrant promoter methylation of the caveolin-1 gene may occur at the precancerous stage, regulated by gender-related factors and is associated with gene silencing of caveolin-1 in the development of colorectal cancer.
15263006 caveolin-1 plays an important role in senescence-associated morphological changes by regulating focal adhesion kinase activity and actin stress fiber formation in the senescent cells.
15240128 Our data demonstrate for the first time that the reduction of the plasma membrane cholesterol level induced by overexpressing caveolin-1 may indirectly inhibit P-gp transport activity by increasing plasma membrane fluidity.
15234575 In four different groups of marrow samples (20 normal, 56 acute myeloid leukemias (AML) at diagnosis, 48 AMLs at relapse, and 51 regenerating marrows), caveolin-1 and MDR-1 gene expressions were positively correlated
15234566 review of coordination of caveolin-1 gene expression regulation with that of MDR1 in cancer cells
15219854 phosphorylation was found in both the acetylated and non-acetylated variants of caveolin-1beta. This variability in modifications is consistent with critical involvement of the N-terminal domain of caveolin in the regulation of caveolae
15205342 Results suggest different roles for CAV1 in SCLC, where CAV1 acts like a tumor suppressor gene, and NSCLC, where it appears required for survival and growth.
15201341 caveolin-1 can inhibit the conversion of LG-CD147 (low glycoform-CD147) to HG-CD147 (high glycoform-CD147)
15190056 Cav-1 has a role in regulating the functional activity of 5-HT(2A) serotonin receptors and Galpha(q)-coupled receptors
15069532 caveolin-1 is overexpressed in experimental colon adenocarcinoma by comparison to adjacent normal mucosa, and its expression in human colon cancer cells is directly associated with the growth rate
15064242 Nitric oxide concentrations could impact on capillary formation via a combination of direct effects on MMP activation and by altering the distribution or abundance of Cav-1 in tumor angiogenesis.
14981899 Cav-1 haploinsufficiency in human breast epithelial cells can lead to partial transformation.
14963033 Ouabain assembles signaling cascades through the caveolar Na+/K+-ATPase.
14729661 overexpression of caveolin-1 in hepatic cells stimulates cholesterol efflux by enhancing transfer of cholesterol to cholesterol-rich domains in the plasma membrane.
14719121 inactivation of Caveolin-1 by a mutation or by reduced expression may play a role in the pathogenesis of oral cancer
14707126 caveolin-1 associates with CD147, in a complex distinct from CD147-alpha(3) integrin complexes, thereby diminishing both CD147 clustering and CD147-dependent MMP-1-inducing activity
14706341 negative regulation of caveolin-1 plays a central role in the complex cellular changes leading to metastasis
14660607 caveolin-1 has a role in mediating astrocyte responses to MCP-1
14645548 Akt activities are largely responsible for cav-1-mediated cell survival
14612902 cytoplasmic overexpression of caveolin-1 predicts a poor prognosis in renal cell carcinoma
12888893 CAV-1 gene can be inactivated through mutations and does not play a role in the development of cervical cancer
12816877 Caveolin-1 is an inhibitor of platelet-derived growth factor (PDGF) proliferative responses and might be capable of transforming PDGF-induced proliferative signals into death signals.
12813462 PPARgamma & caveolin-1 may coexist in a complex. PPARgamma participates in the regulation of caveolin gene expression in human carcinoma cells. Caveolin-1 may mediate some of the phenotypic changes induced by PPAR-G in cancer cells.
12810205 A statistically significant difference in the expression of caveolin-1 between oncocytoma with a mean labeling index of 91.7 and other malignant renal tumors with a lower mean labeling index possibly implicates this peptide in oncocytoma pathogenesis.
12737162 Caveolin-1 expression is an independent positive prognostic factor for survival in extrahepatic bile duct carcinoma.
12732636 Caveolin-1 contributes to assembly of store-operated Ca2+ influx channels by regulating plasma membrane localization of TRPC1.
12730243 caveolin has a role in recovery from cell sensecence
12716887 Caveolin-1 may modify the biosynthetic pathway of sugar chains via the regulation of the intra-Golgi subcompartment localization of N-acetylglucosaminyltransferase III
12711000 ERalpha co-activator caveolin is negatively regulated by the steroid receptor itself
12694195 interacts with endothlin b receptor
12648214 caveolin-1 may play a role in lamellar granule assembly, trafficking, and/or function.
12606314 Caveolae plays a role in signal-transducing function of cardiac Na+/K+-ATPase.
12562842 basal and SR-BI-stimulated free cholesterol efflux to HDL and liposomes and SR-BI-mediated selective uptake of HDL cholesteryl ester are not affected by caveolin-1 expression
12414512 Up-regulated caveolin-1 accentuates the metastasis capability of lung adenocarcinoma by inducing filopodia formation.
12401329 In the cerebral cortex caveolin-1 is expressed by all the cell types that form the vascular wall, endothelial cells, pericytes, and vascular astrocytes in vivo.
12372346 Caveolin-1 phosphorylation in human squamous cell carcinoma is dependent on ErbB1 expression and Src activation.
12368209 data clearly implicate loss of functional Cav-1 in the pathogenesis of mammary epithelial cell hyperplasia
12359771 Endostatin associates with integrin alpha5beta1 and caveolin-1, and activates Src via a tyrosyl phosphatase-dependent pathway in human endothelial cells.
12354760 both the caveolin-1/EGFR association and EGF-induced tyrosine phosphorylation of caveolin-1 are modulated by ganglioside GM3
12235142 Data show that IL-6/raft/STAT3 signaling is a chaperoned pathway that involves caveolin-1 and HSP90 as accessory proteins and suggest a mechanism for the preservation of this signaling during fever.
12186899 data show that coexpression of caveolin can markedly inhibit expression of HIV proviral DNA and establish that the inhibition is mediated by the hydrophobic, membrane-associated domain
12185081 regulation of expression and secretion by a protein kinase c epsilon signaling pathway in human prostate cancer cells
12176037 Some protein tyrosine phosphatases form molecular complexes with caveolin-1 in lipid rafts
12138116 Data show that ER alpha and not ER beta silences caveolin-1/-2 expression in an epigenetic fashion in neuronal cells.
12011038 Neu3 functions as a caveolin-related signaling molecule within caveolin-rich microdomains
11920460 over-expression is associated with lymph node metastasis and worse prognosis after surgery in esophageal squamous cell carcinoma
11915322 forms a cholesterol complex and transports it from the endoplasmic reticulum to the cell membrane; activates signal transduction molecules
11845324 CAV1 was found in liver endothelial cells and in Kupffer cells (liver non-parenchymal cells).
11748236 Caveolin-1 expression enhances endothelial capillary tubule formation

AA Sequence

MSGGKYVDSEGHLYTVPIREQGNIYKPNNKAMADELSEKQVYDAHTKEIDLVNRDPKHLNDDVVKIDFED      1 - 70
VIAEPEGTHSFDGIWKASFTTFTVTKYWFYRLLSALFGIPMALIWGIYFAILSFLHIWAVVPCIKSFLIE     71 - 140
IQCISRVYSIYVHTVCDPLFEAVGKIFSNVRINLQKEI                                    141 - 178
//

Text Mined References (738)

PMID Year Title
27094744 2016 Hypoxia regulates global membrane protein endocytosis through caveolin-1 in cancer cells.
26876307 2016 Epithelial membrane protein 2 regulates sphingosylphosphorylcholine-induced keratin 8 phosphorylation and reorganization: Changes of PP2A expression by interaction with alpha4 and caveolin-1 in lung cancer cells.
26837700 2016 Caveolin-1 regulates TCR signal strength and regulatory T-cell differentiation into alloreactive T cells.
26828798 2016 The Impact of Simulated Weightlessness on Endothelium-Dependent Angiogenesis and the Role of Caveolae/Caveolin-1.
26797118 2016 The Ankrd13 Family of Ubiquitin-interacting Motif-bearing Proteins Regulates Valosin-containing Protein/p97 Protein-mediated Lysosomal Trafficking of Caveolin 1.
26794448 2016 Epigenetic drift towards histone modifications regulates CAV1 gene expression in colon cancer.
26725982 2016 ROR1 sustains caveolae and survival signalling as a scaffold of cavin-1 and caveolin-1.
26717806 2016 Caveolin-1 is essential in the differentiation of human adipose-derived stem cells into hepatocyte-like cells via an MAPK pathway-dependent mechanism.
26626726 2015 Promotion of human mesenchymal stem cell osteogenesis by PI3-kinase/Akt signaling, and the influence of caveolin-1/cholesterol homeostasis.
26615831 2015 Direct Regulation of TLR5 Expression by Caveolin-1.
26602865 2016 Uncoupling Caveolae From Intracellular Signaling In Vivo.
26566034 2015 Conserved Molecular Underpinnings and Characterization of a Role for Caveolin-1 in the Tumor Microenvironment of Mature T-Cell Lymphomas.
26543228 2016 Caveolin-1 regulates cancer cell metabolism via scavenging Nrf2 and suppressing MnSOD-driven glycolysis.
26543085 Significant Association of Caveolin-1 and Caveolin-2 with Prostate Cancer Progression.
26539466 2015 Serum Caveolin-1 as a Novel Biomarker in Idiopathic Pulmonary Artery Hypertension.
26503358 2015 Caveolin-1 mediates chemoresistance in cisplatin-resistant ovarian cancer cells by targeting apoptosis through the Notch-1/Akt/NF-?B pathway.
26497787 2015 Advances in glaucoma genetics.
26475177 2015 A prevalent caveolin-1 gene variant is associated with the metabolic syndrome in Caucasians and Hispanics.
26474461 2015 Caveolin-1-negative head and neck squamous cell carcinoma primary tumors display increased epithelial to mesenchymal transition and prometastatic properties.
26357463 2015 Lipopolysaccharide-induced caveolin-1 phosphorylation-dependent increase in transcellular permeability precedes the increase in paracellular permeability.
26354438 2015 Lateral diffusion, function, and expression of the slow channel congenital myasthenia syndrome ?C418W nicotinic receptor mutation with changes in lipid raft components.
26315660 2015 CAVEOLIN-1 expression in brain metastasis from lung cancer predicts worse outcome and radioresistance, irrespective of tumor histotype.
26307673 2015 A caveolin-dependent and PI3K/AKT-independent role of PTEN in ?-catenin transcriptional activity.
26259513 2015 IFITM1 promotes the metastasis of human colorectal cancer via CAV-1.
26255449 2015 Expression of caveolin-1 in peritumoral stroma is associated with histological grade in ovarian serous tumors.
26251082 2015 Differentiation of high-risk stage I and II colon tumors based on evaluation of CAV1 gene expression.
26189259 2015 Cervical squamous cancer mRNA profiles reveal the key genes of metastasis and invasion.
26172389 2015 Caveolin-1 Dependent Endocytosis Enhances the Chemosensitivity of HER-2 Positive Breast Cancer Cells to Trastuzumab Emtansine (T-DM1).
26169283 2015 HIV inhibits endothelial reverse cholesterol transport through impacting subcellular Caveolin-1 trafficking.
26138883 2015 Caveolin-1 Confers Resistance of Hepatoma Cells to Anoikis by Activating IGF-1 Pathway.
26123189 2015 Stromal Caveolin-1 Is Associated With Response and Survival in a Phase II Trial of nab-Paclitaxel With Carboplatin for Advanced NSCLC Patients.
26086560 2015 Increases in endothelial caveolin-1 and cavins correlate with cirrhosis progression.
26085308 2015 Association of membrane/lipid rafts with the platelet cytoskeleton and the caveolin PY14: participation in the adhesion process.
26072376 2015 Expression of CAVEOLIN 1 in uterine mesenchymal tumors: No relationship between malignancy and CAVEOLIN 1 expression.
26066055 2015 Genetic Variants in Caveolin-1 and RhoA/ROCK1 Are Associated with Clear Cell Renal Cell Carcinoma Risk in a Chinese Population.
26065715 2015 Caveolin-1 is Associated with Tumor Progression and Confers a Multi-Modality Resistance Phenotype in Pancreatic Cancer.
26054531 2015 Enhanced caveolin-1 expression increases migration, anchorage-independent growth and invasion of endometrial adenocarcinoma cells.
26025399 2015 Molecular events are associated with resistance to vinblastine in bladder cancer.
26015768 2015 Expression-associated polymorphisms of CAV1-CAV2 affect intraocular pressure and high-tension glaucoma risk.
25998683 2015 Internalization of the TGF-? type I receptor into caveolin-1 and EEA1 double-positive early endosomes.
25953654 2015 Significant Association Between CAV1 Variant rs3807989 on 7p31 and Atrial Fibrillation in a Chinese Han Population.
25945613 2015 Critical role of CAV1/caveolin-1 in cell stress responses in human breast cancer cells via modulation of lysosomal function and autophagy.
25940406 2015 Evaluation of the CAV1 gene in clinically, sonographically and histologically proven morphea patients.
25898808 2015 Whole exome sequencing identifies de novo heterozygous CAV1 mutations associated with a novel neonatal onset lipodystrophy syndrome.
25893292 2016 Syntenin regulates TGF-?1-induced Smad activation and the epithelial-to-mesenchymal transition by inhibiting caveolin-mediated TGF-? type I receptor internalization.
25892494 2015 A novel chimeric aequorin fused with caveolin-1 reveals a sphingosine kinase 1-regulated Ca²? microdomain in the caveolar compartment.
25877996 2015 Upregulation of Caveolin-1 correlate with Akt expression and poor prognosis in NPC patients.
25853335 2015 Deceased donor multidrug resistance protein 1 and caveolin 1 gene variants may influence allograft survival in kidney transplantation.
25848073 2015 Caveolin-1 Deficiency Inhibits the Basolateral K+ Channels in the Distal Convoluted Tubule and Impairs Renal K+ and Mg2+ Transport.
25842166 2015 Caveolin-1 is transcribed from a hypermethylated promoter to mediate colonocyte differentiation and apoptosis.
25822667 2015 Cavin-1 and Caveolin-1 are both required to support cell proliferation, migration and anchorage-independent cell growth in rhabdomyosarcoma.
25787790 2015 Genetic variation in caveolin-1 correlates with long-term pancreas transplant function.
25707739 2015 Placental expression of eNOS, iNOS and the major protein components of caveolae in women with pre-eclampsia.
25672415 2015 Protein-protein interaction between caveolin-1 and SHP-2 is dependent on the N-SH2 domain of SHP-2.
25665524 2015 Pharmacological modulation of the AKT/microRNA-199a-5p/CAV1 pathway ameliorates cystic fibrosis lung hyper-inflammation.
25658354 2015 Caveolin-1, galectin-3 and lipid raft domains in cancer cell signalling.
25658089 2015 SMAD-independent down-regulation of caveolin-1 by TGF-?: effects on proliferation and survival of myofibroblasts.
25645930 2015 Distinct structural domains of caveolin-1 independently regulate Ca2+ release-activated Ca2+ channels and Ca2+ microdomain-dependent gene expression.
25633184 2015 Caveolin-1 accumulation in the tongue cancer tumor microenvironment is significantly associated with poor prognosis: an in-vivo and in-vitro study.
25632186 2015 Loss of stromal caveolin-1 expression in colorectal cancer predicts poor survival.
25626893 2015 Caveolin-1 mediates gene transfer and cytotoxicity of polyethyleneimine in mammalian cell lines.
25588833 2015 Cavin3 interacts with cavin1 and caveolin1 to increase surface dynamics of caveolae.
25575822 2015 Methyl-?-cyclodextrin up-regulates collagen I expression in chronologically-aged skin via its anti-caveolin-1 activity.
25556234 2015 New host factors important for respiratory syncytial virus (RSV) replication revealed by a novel microfluidics screen for interactors of matrix (M) protein.
25551286 2014 Caveolin-1 mediated uptake via langerin restricts HIV-1 infection in human Langerhans cells.
25550395 2014 Caveolin-1 deficiency induces a MEK-ERK1/2-Snail-1-dependent epithelial-mesenchymal transition and fibrosis during peritoneal dialysis.
25525164 2014 Exome array analysis identifies CAV1/CAV2 as a susceptibility locus for intraocular pressure.
25489222 2014 Association of known common genetic variants with primary open angle, primary angle closure, and pseudoexfoliation glaucoma in Pakistani cohorts.
25455218 2014 Endocytosis of Streptococcus pneumoniae via the polymeric immunoglobulin receptor of epithelial cells relies on clathrin and caveolin dependent mechanisms.
25407491 2015 miR-103/107 modulates multidrug resistance in human gastric carcinoma by downregulating Cav-1.
25397596 2014 Caveolin-1 limits the contribution of BKCa channel to MCF-7 breast cancer cell proliferation and invasion.
25351339 2015 Caveolin-1 regulates metastatic behaviors of anoikis resistant lung cancer cells.
25339030 2014 Prognostic value of caveolin-1 expression in gastric cancer: a meta-analysis.
25337248 2014 Prognostic and predictive values of SPP1, PAI and caveolin-1 in patients with oral squamous cell carcinoma.
25313138 2014 Caveolin-1 is down-regulated in alveolar rhabdomyosarcomas and negatively regulates tumor growth.
25246063 2014 Association of caveolin-1 genotypes with renal cell carcinoma risk in Taiwan.
25204797 2014 Flotillin-1 facilitates toll-like receptor 3 signaling in human endothelial cells.
25196315 2015 The rs3807989 G/A polymorphism in CAV1 is associated with the risk of atrial fibrillation in Chinese Han populations.
25192721 2014 Elucidation of caveolin 1 both as a tumor suppressor and metastasis promoter in light of epigenetic modulators.
25180681 2014 CAV1 promotes HCC cell progression and metastasis through Wnt/?-catenin pathway.
25173106 2014 Genome-wide analysis of multi-ancestry cohorts identifies new loci influencing intraocular pressure and susceptibility to glaucoma.
25173105 2014 Common variants near ABCA1, AFAP1 and GMDS confer risk of primary open-angle glaucoma.
25148256 2014 Reciprocal activating crosstalk between c-Met and caveolin 1 promotes invasive phenotype in hepatocellular carcinoma.
25123270 2014 Caveolin-1 in oral squamous cell carcinoma microenvironment: an overview.
25120818 2014 Lack of association between rs3807989 in cav1 and atrial fibrillation.
25117072 2014 Genetic variations of CAV1 gene contribute to HCC risk: a case-control study.
25085904 2014 Caveolin-1 mediates chemoresistance in breast cancer stem cells via ?-catenin/ABCG2 signaling pathway.
25055868 2014 Genome-wide association study of electrocardiographic parameters identifies a new association for PR interval and confirms previously reported associations.
25035420 2014 Identification of three novel genetic variations associated with electrocardiographic traits (QRS duration and PR interval) in East Asians.
25017566 2014 Caveolin-1 functions as a key regulator of 17?-estradiol-mediated autophagy and apoptosis in BT474 breast cancer cells.
25006397 2013 Nitrosation-dependent caveolin 1 phosphorylation, ubiquitination, and degradation and its association with idiopathic pulmonary arterial hypertension.
25002533 2014 Caveolin-1 is required for kinase suppressor of Ras 1 (KSR1)-mediated extracellular signal-regulated kinase 1/2 activation, H-RasV12-induced senescence, and transformation.
24998359 2014 Interactions of caveolin-1 scaffolding and intramembrane regions containing a CRAC motif with cholesterol in lipid bilayers.
24969108 2014 Caveolin-1 expression and cavin stability regulate caveolae dynamics in adipocyte lipid store fluctuation.
24968949 2014 CAV-1 contributes to bladder cancer progression by inducing epithelial-to-mesenchymal transition.
24967418 2014 Prolonged nitric oxide exposure enhances anoikis resistance and migration through epithelial-mesenchymal transition and caveolin-1 upregulation.
24952745 2014 Genetic association study of QT interval highlights role for calcium signaling pathways in myocardial repolarization.
24949874 2014 Loss of stromal caveolin-1 expression: a novel tumor microenvironment biomarker that can predict poor clinical outcomes for pancreatic cancer.
24939878 2014 Caveolin-1 regulates lung cancer stem-like cell induction and p53 inactivation in carbon nanotube-driven tumorigenesis.
24909339 2014 Differential expression of caveolin-1 in human myometrial and uterine leiomyoma smooth muscle.
24885118 2014 Temporal evolution in caveolin 1 methylation levels during human esophageal carcinogenesis.
24850809 2014 Genetic determinants of P wave duration and PR segment.
24840271 2014 Src/caveolin-1-regulated EGFR activation antagonizes TRAIL-induced apoptosis in gastric cancer cells.
24831264 2014 Caveolin-1 promotes an invasive phenotype and predicts poor prognosis in large cell lung carcinoma.
24815842 A novel caveolin-1 biomarker for clinical outcome of sarcopenia.
24801727 2014 Caveolin-1 and ATP binding cassette transporter A1 and G1-mediated cholesterol efflux.
24782297 2014 Caveolin-1 expression in odontogenic cysts and ameloblastomas.
24778029 2014 Association of caveolin-1 genotypes with gastric cancer in Taiwan.
24742020 2014 Role of caveolin-1 in asthma and chronic inflammatory respiratory diseases.
24727585 2014 Interaction of caveolin-1 with ATG12-ATG5 system suppresses autophagy in lung epithelial cells.
24710718 2014 Caveolin-1 is essential for protecting against binge drinking-induced liver damage through inhibiting reactive nitrogen species.
24705869 2014 C-terminus of human BKca channel alpha subunit enhances the permeability of the brain endothelial cells by interacting with caveolin-1 and triggering caveolin-1 intracellular trafficking.
24659799 2014 Rab5 is required in metastatic cancer cells for Caveolin-1-enhanced Rac1 activation, migration and invasion.
24658140 2014 The mammalian-membrane two-hybrid assay (MaMTH) for probing membrane-protein interactions in human cells.
24648521 2014 Deciphering the binding of caveolin-1 to client protein endothelial nitric-oxide synthase (eNOS): scaffolding subdomain identification, interaction modeling, and biological significance.
24643062 2014 Caveolin-1 in lipid rafts interacts with dengue virus NS3 during polyprotein processing and replication in HMEC-1 cells.
24625804 2014 Caveolin-1 mediates Salmonella invasion via the regulation of SopE-dependent Rac1 activation and actin reorganization.
24621537 2014 Genetic variation in caveolin-1 affects survival after lung transplantation.
24609521 2014 Duplex value of caveolin-1 in non-small cell lung cancer: a meta analysis.
24604116 2014 Caveolin 1 knockdown inhibits the proliferation, migration and invasion of human breast cancer BT474 cells.
24590865 2014 Breast cancer nodal metastasis correlates with tumour and lymph node methylation profiles of Caveolin-1 and CXCR4.
24578173 2014 Caveolin-1 deficiency may predispose African Americans to systemic sclerosis-related interstitial lung disease.
24576892 2014 Caveolin-1 interacts with ATP binding cassette transporter G1 (ABCG1) and regulates ABCG1-mediated cholesterol efflux.
24572674 2014 Association of CAV1/CAV2 genomic variants with primary open-angle glaucoma overall and by gender and pattern of visual field loss.
24533441 2014 Simultaneous expression of flotillin-1, flotillin-2, stomatin and caveolin-1 in non-small cell lung cancer and soft tissue sarcomas.
24454806 2014 Role of caveolin-1 in atrial fibrillation as an anti-fibrotic signaling molecule in human atrial fibroblasts.
24454730 2014 Caveolin-1 is up-regulated by GLI1 and contributes to GLI1-driven EMT in hepatocellular carcinoma.
24427291 2014 Phosphocaveolin-1 enforces tumor growth and chemoresistance in rhabdomyosarcoma.
24397980 2014 Adiponectin inhibits tumor necrosis factor-?-induced vascular inflammatory response via caveolin-mediated ceramidase recruitment and activation.
24390341 2014 Endothelial caveolin-1 plays a major role in the development of atherosclerosis.
24354620 2014 Gas6-induced tissue factor expression in endothelial cells is mediated through caveolin-1-enriched microdomains.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24255086 2014 Caveolin-1 expression in papillary thyroid carcinoma: correlation with clinicopathological parameters and BRAF mutation status.
24222128 2013 Significant association of caveolin-1 (CAV1) genotypes with upper urothelial tract cancer.
24211445 2013 Live-cell single-molecule imaging reveals clathrin and caveolin-1 dependent docking of SMAD4 at the cell membrane.
24130882 2013 Inhibition of caveolin-1 restores myeloid cell function in human glioblastoma.
24119769 2013 Caveolin-1 in renal cell carcinoma promotes tumour cell invasion, and in co-operation with pERK predicts metastases in patients with clinically confined disease.
24089527 2013 Caveolin-1 interacts with Derlin-1 and promotes ubiquitination and degradation of cyclooxygenase-2 via collaboration with p97 complex.
24065198 2014 Interaction among Caveolin-1 genotypes (rs3807987/rs7804372), H. pylori infection, and risk of gastric cancer in a Chinese population.
24034151 2014 Association of single-nucleotide polymorphism rs4236601 near caveolin 1 and 2 with primary open-angle glaucoma: a meta-analysis.
24013648 2013 Molecular composition and ultrastructure of the caveolar coat complex.
23982252 2014 Down-regulation of stromal caveolin-1 expression in esophageal squamous cell carcinoma: a potent predictor of lymph node metastases, early tumor recurrence, and poor prognosis.
23963167 2013 Investigation of known genetic risk factors for primary open angle glaucoma in two populations of African ancestry.
23951165 2013 EphA2-induced angiogenesis in ewing sarcoma cells works through bFGF production and is dependent on caveolin-1.
23938946 2013 Caveola-forming proteins caveolin-1 and PTRF in prostate cancer.
23934189 2014 PTRF/cavin-1 neutralizes non-caveolar caveolin-1 microdomains in prostate cancer.
23907124 2013 Loss of caveolin-1 and gain of MCT4 expression in the tumor stroma: key events in the progression from an in situ to an invasive breast carcinoma.
23894397 2013 Caveolin-1 single nucleotide polymorphism in antineutrophil cytoplasmic antibody associated vasculitis.
23845778 2013 Lowered expression levels of a tumor suppressor gene - caveolin-1 within dysregulated gene networks of Fanconi anemia.
23836408 2013 Loss of caveolin-1 promotes endothelial-mesenchymal transition during sepsis: a membrane proteomic study.
23770857 2014 Cavin-1 is essential for the tumor-promoting effect of caveolin-1 and enhances its prognostic potency in pancreatic cancer.
23748364 2014 The impact of APOL1, CAV1, and ABCB1 gene variants on outcomes in kidney transplantation: donor and recipient effects.
23743525 2013 Association study of genetic variants on chromosome 7q31 with susceptibility to normal tension glaucoma in a Japanese population.
23742006 2013 Caveolin-1 controls airway epithelial barrier function. Implications for asthma.
23736812 2013 Epigenetic modulation of signal transduction pathways in HPV-associated HNSCC.
23729330 2013 Loss of caveolin-1 in prostate cancer stroma correlates with reduced relapse-free survival and is functionally relevant to tumour progression.
23723070 2013 AMP-dependent kinase inhibits oxidative stress-induced caveolin-1 phosphorylation and endocytosis by suppressing the dissociation between c-Abl and Prdx1 proteins in endothelial cells.
23723060 2013 Leptin promotes neointima formation and smooth muscle cell proliferation via NADPH oxidase activation and signalling in caveolin-rich microdomains.
23717204 2013 Pilus phase variation switches gonococcal adherence to invasion by caveolin-1-dependent host cell signaling.
23653359 2013 Exosome uptake depends on ERK1/2-heat shock protein 27 signaling and lipid Raft-mediated endocytosis negatively regulated by caveolin-1.
23645736 2013 Increased plasma caveolin-1 levels are associated with progression of prostate cancer among Japanese men.
23637463 2013 Inhibition of nuclear factor-erythroid 2-related factor (Nrf2) by caveolin-1 promotes stress-induced premature senescence.
23606537 2013 Reduced caveolin-1 promotes hyperinflammation due to abnormal heme oxygenase-1 localization in lipopolysaccharide-challenged macrophages with dysfunctional cystic fibrosis transmembrane conductance regulator.
23603343 Significant association of caveolin-1 single nucleotide polymorphisms with childhood leukemia in Taiwan.
23598720 2013 PPAR? promotes oncogenic redirection of TGF-?1 signaling through the activation of the ABCA1-Cav1 pathway.
23598719 2013 Caveolin-1 is a negative regulator of tumor growth in glioblastoma and modulates chemosensitivity to temozolomide.
23583521 2013 Role of caveolin-1 in fibrotic diseases.
23583380 2013 Prominin-2 expression increases protrusions, decreases caveolae and inhibits Cdc42 dependent fluid phase endocytosis.
23580232 2013 FoxO3a (Forkhead Box O3a) deficiency protects Idiopathic Pulmonary Fibrosis (IPF) fibroblasts from type I polymerized collagen matrix-induced apoptosis via caveolin-1 (cav-1) and Fas.
23580180 2013 Vascular endothelial growth factor receptors 1,3 and caveolin-1 are implicated in colorectal cancer aggressiveness and prognosis--correlations with epidermal growth factor receptor, CD44v6, focal adhesion kinase, and c-Met.
23527097 2013 Caveolin-1 expression level in cancer associated fibroblasts predicts outcome in gastric cancer.
23482776 2013 Functional polymorphism in the CAV1 T29107A gene and its association with prostate cancer risk among Japanese men.
23463606 2013 Knock down of caveolin-1 affects morphological and functional hallmarks of human endothelial cells.
23460862 2013 Caveolin-1 regulates endothelial adhesion of lung cancer cells via reactive oxygen species-dependent mechanism.
23442759 2013 The expression and functionality of stromal caveolin 1 in human adenomyosis.
23428975 2013 Secreted caveolin-1 enhances periodontal inflammation by targeting gingival fibroblasts.
23404184 2013 Caveolin-1 and polymerase I and transcript release factor: new players in insulin-like growth factor-I receptor signaling.
23393366 2013 The contribution of caveolin-1 genotype and phenotype to hepatocellular carcinoma.
23383114 2013 Caveolin-1 regulates Rac1 activation and rat pulmonary microvascular endothelial hyperpermeability induced by TNF-?.
23352616 2013 Caveolin-1 interacts with protein phosphatase 5 and modulates its activity in prostate cancer cells.
23339905 2013 Membrane glucocorticoid receptor activation induces proteomic changes aligning with classical glucocorticoid effects.
23335559 2013 Ubiquitination of the N-terminal region of caveolin-1 regulates endosomal sorting by the VCP/p97 AAA-ATPase.
23302227 2013 Caveolin-1-LRP6 signaling module stimulates aerobic glycolysis in prostate cancer.
23300727 2012 Exo70 subunit of the exocyst complex is involved in adhesion-dependent trafficking of caveolin-1.
23283514 2013 PrP octarepeats region determined the interaction with caveolin-1 and phosphorylation of caveolin-1 and Fyn.
23280667 2013 Caveolin-1 is a novel regulator of K-RAS-dependent migration in colon carcinogenesis.
23271292 2012 Caveolin-1 is involved in radiation-induced ERBB2 nuclear transport in breast cancer cells.
23267770 2013 Cav1 suppresses tumor growth and metastasis in a murine model of cutaneous SCC through modulation of MAPK/AP-1 activation.
23262137 2013 The myosin motor Myo1c is required for VEGFR2 delivery to the cell surface and for angiogenic signaling.
23228128 2013 The caveolin-1 connection to cell death and survival.
23206456 2012 Inverse correlation between caveolin-1 expression and clinical severity in psoriasis vulgaris.
23203033 2012 Quantum dots-based immunofluorescent imaging of stromal fibroblasts Caveolin-1 and light chain 3B expression and identification of their clinical significance in human gastric cancer.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23139255 2012 Novel loci associated with PR interval in a genome-wide association study of 10 African American cohorts.
23128390 2013 CpG island shore methylation regulates caveolin-1 expression in breast cancer.
23117935 2013 Relation between ultrastructural localization, changes in caveolin-1, and capillarization of liver sinusoidal endothelial cells in human hepatitis C-related cirrhotic liver.
23114650 2013 Divergent control of Cav-1 expression in non-cancerous Li-Fraumeni syndrome and human cancer cell lines.
23067370 2012 Caveolin-1 reduces HIV-1 infectivity by restoration of HIV Nef mediated impairment of cholesterol efflux by apoA-I.
23056496 2012 Oligomerization of Clostridium perfringens epsilon toxin is dependent upon caveolins 1 and 2.
23004679 2012 Loss of caveolin-1 from bronchial epithelial cells and monocytes in human subjects with asthma.
22931092 2012 Long-term hydrogen peroxide exposure potentiates anoikis resistance and anchorage-independent growth in lung carcinoma cells.
22898083 2012 Caveolin-1 knockdown is associated with the metastasis and proliferation of human lung cancer cell line NCI-H460.
22894556 2012 Hepatitis B virus X protein suppresses caveolin-1 expression in hepatocellular carcinoma by regulating DNA methylation.
22883991 2012 [Expressions of caveolin-1 and extracellular matrix in lung tissues of patients with idiopathic pulmonary fibrosis].
22883195 2012 [Depot-specific expression of caveolin-1 in human adipose tissue and their relationship with obesity and insulin resistance].
22824620 2012 Sodium arsenite-induced abnormalities in expressions of Caveolin-1, eNOS, IKK?, and COX-2 in SV-40 immortalized human uroepithelial cells and in urothelial carcinomas.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22807396 2012 Caveolin-1 regulates proliferation and osteogenic differentiation of human mesenchymal stem cells.
22792322 2012 The E3-ubiquitin ligase TRIM50 interacts with HDAC6 and p62, and promotes the sequestration and clearance of ubiquitinated proteins into the aggresome.
22772753 2012 Caveolin-1 plays a critical role in the differentiation of monocytes into macrophages.
22748181 2012 Caveolin-1 suppresses human immunodeficiency virus-1 replication by inhibiting acetylation of NF-?B.
22745744 2012 Interaction of caveolin-1 with Ku70 inhibits Bax-mediated apoptosis.
22730441 2012 Leptin signaling in adipose tissue: role in lipid accumulation and weight gain.
22706202 2012 Caveolin-1 increases aerobic glycolysis in colorectal cancers by stimulating HMGA1-mediated GLUT3 transcription.
22693251 2012 Functional interaction of tumor suppressor DLC1 and caveolin-1 in cancer cells.
22674854 2013 Restoration of caveolin-1 expression suppresses growth, membrane-type-4 metalloproteinase expression and metastasis-associated activities in colon cancer cells.
22659071 2012 Haplotypes across the human caveolin 1 gene upstream purine complex significantly alter gene expression: implication in neurodegenerative disorders.
22593443 2012 Acquisition of anoikis resistance up-regulates caveolin-1 expression in human non-small cell lung cancer cells.
22575653 2012 Multiparametric image analysis reveals role of Caveolin1 in endosomal progression rather than internalization of EGFR.
22571278 2012 Lymph node-induced immune tolerance in chronic lymphocytic leukaemia: a role for caveolin-1.
22564243 2012 Caveolin-1 interferes cell growth of lung cancer NCI-H446 cell through the interactions with phospho-ERK1/2, estrogen receptor and progestin receptor.
22547813 2012 Malignant hyperthermia susceptibility arising from altered resting coupling between the skeletal muscle L-type Ca2+ channel and the type 1 ryanodine receptor.
22547061 2012 Caveolin-1 inhibits expression of antioxidant enzymes through direct interaction with nuclear erythroid 2 p45-related factor-2 (Nrf2).
22544366 2012 Meta-analysis identifies six new susceptibility loci for atrial fibrillation.
22528500 2012 Caveolin-1 and dynamin-2 are essential for removal of the complement C5b-9 complex via endocytosis.
22513979 2012 Coordinated expression of galectin-3 and caveolin-1 in thyroid cancer.
22506673 2012 Probing the caveolin-1 P132L mutant: critical insights into its oligomeric behavior and structure.
22502704 2012 5'-CpG island promoter hypermethylation of the CAV-1 gene in breast cancer patients of Kashmir.
22474227 2012 Whole exome sequencing to identify a novel gene (caveolin-1) associated with human pulmonary arterial hypertension.
22474125 2012 Bile acids down-regulate caveolin-1 in esophageal epithelial cells through sterol responsive element-binding protein.
22454521 2012 Caveolar domain organization and trafficking is regulated by Abl kinases and mDia1.
22433870 2012 Tyrosine-phosphorylated caveolin-1 (Tyr-14) increases sensitivity to paclitaxel by inhibiting BCL2 and BCLxL proteins via c-Jun N-terminal kinase (JNK).
22411794 2012 Hypoxia promotes ligand-independent EGF receptor signaling via hypoxia-inducible factor-mediated upregulation of caveolin-1.
22402147 2012 Evidence for caveolin-1 as a new susceptibility gene regulating tissue fibrosis in systemic sclerosis.
22395498 2012 Nestin and caveolin-1 in the diagnosis of GISTs.
22378247 2012 Expression of Cav-1 in tumour cells, rather than in stromal tissue, may promote cervical squamous cell carcinoma proliferation, and correlates with high-risk HPV infection.
22370641 2013 WNT6 is a novel target gene of caveolin-1 promoting chemoresistance to epirubicin in human gastric cancer cells.
22353809 2012 The interrelationships between Src, Cav-1 and RhoGD12 in transitional cell carcinoma of the bladder.
22353223 2011 Caveolin involvement and modulation in breast cancer.
22323292 2012 Nitric oxide-dependent Src activation and resultant caveolin-1 phosphorylation promote eNOS/caveolin-1 binding and eNOS inhibition.
22316086 2012 Lipid raft/caveolae signaling is required for Cryptococcus neoformans invasion into human brain microvascular endothelial cells.
22287735 2012 Caveolin-1 attenuates hydrogen peroxide-induced oxidative damage to lung carcinoma cells.
22277751 2012 Caveolin-1 regulates Mcl-1 stability and anoikis in lung carcinoma cells.
22277251 2012 Elevated expression of cav-1 in a subset of SSc fibroblasts contributes to constitutive Alk1/Smad1 activation.
22241747 2012 Caveolin-1 regulation of store-operated Ca(2+) influx in human airway smooth muscle.
22240009 2012 The transmembrane domain of caveolin-1 exhibits a helix-break-helix structure.
22238363 2012 Caveolin targeting to late endosome/lysosomal membranes is induced by perturbations of lysosomal pH and cholesterol content.
22236542 2012 Expression of caveolin-1, caveolin-2 and caveolin-3 in thyroid cancer and stroma.
22215724 2012 Activated CD47 promotes pulmonary arterial hypertension through targeting caveolin-1.
22201996 2012 Prognostic relevance of the expressions of CAV1 and TES genes on 7q31 in melanoma.
22200856 2012 Expression of caveolin-1 is correlated with disease stage and survival in lung adenocarcinomas.
22194465 2012 A novel FoxM1-caveolin signaling pathway promotes pancreatic cancer invasion and metastasis.
22159333 2012 Caveolin-1 as a potential high-risk prostate cancer biomarker.
22152020 2011 Caveolin 1 protein expression in renal cell carcinoma predicts survival.
22142403 2012 Structural characterization of the caveolin scaffolding domain in association with cholesterol-rich membranes.
22134245 2011 Loss of stromal caveolin-1 expression in malignant melanoma metastases predicts poor survival.
22128235 2011 Expression of caveolin in trabecular meshwork cells and its possible implication in pathogenesis of primary open angle glaucoma.
22127416 2012 SorLA in glia: shared subcellular distribution patterns with caveolin-1.
22095627 2012 Hyperoxia-induced LC3B interacts with the Fas apoptotic pathway in epithelial cell death.
22075971 2012 Expression of endothelial factors in prostate cancer: a possible role of caveolin-1 for tumour progression.
22072235 2012 Caveolin-1 overexpression is associated with hepatocellular carcinoma tumourigenesis and metastasis.
22057638 2012 Stromal caveolin-1 expression in breast carcinoma. Correlation with early tumor recurrence and clinical outcome.
22041584 2011 Caveolin-1 promotes pancreatic cancer cell differentiation and restores membranous E-cadherin via suppression of the epithelial-mesenchymal transition.
22038047 2012 Caveolin-1 is essential for metformin inhibitory effect on IGF1 action in non-small-cell lung cancer cells.
21976276 2012 eNOS and caveolin-1 gene polymorphisms interaction and intima media thickness: a proof of concept study in ESRD patients.
21965789 2011 Association of caveolin-1 genotypes with nasopharyngeal carcinoma susceptibility in Taiwan.
21965771 2011 Significant association of caveolin-1 (CAV1) genotypes with breast cancer in Taiwan.
21951852 2011 Interaction abolishment between mutant caveolin-1(?62-100) and ABCA1 reduces HDL-mediated cellular cholesterol efflux.
21949119 2011 A glycosphingolipid/caveolin-1 signaling complex inhibits motility of human ovarian carcinoma cells.
21925842 2011 Caveolin-1 is a negative regulator of MMP-1 gene expression in human dermal fibroblasts via inhibition of Erk1/2/Ets1 signaling pathway.
21918362 2011 Caveolin-1 is involved in reactive oxygen species-induced SHP-2 activation in astrocytes.
21909981 2012 Non-existence of caveolin-1 gene mutations in human breast cancer.
21901744 2012 Involvement of the TGF? pathway in the regulation of ?5 ?1 integrins by caveolin-1 in human glioblastoma.
21882259 2012 Down-regulation of Connexin43 expression reveals the involvement of caveolin-1 containing lipid rafts in human U251 glioblastoma cell invasion.
21873608 2011 Common variants near CAV1 and CAV2 are associated with primary open-angle glaucoma in Caucasians from the USA.
21861625 2011 Recruitment of ?7 nicotinic acetylcholine receptor to caveolin-1-enriched lipid rafts is required for nicotine-enhanced Escherichia coli K1 entry into brain endothelial cells.
21841821 2012 A role for caveolin-1 in desmoglein binding and desmosome dynamics.
21840940 2011 PPAR? and PPAR? protect against HIV-1-induced MMP-9 overexpression via caveolae-associated ERK and Akt signaling.
21822278 2011 Endolysosomal sorting of ubiquitylated caveolin-1 is regulated by VCP and UBXD1 and impaired by VCP disease mutations.
21804187 2011 A noninhibitory mutant of the caveolin-1 scaffolding domain enhances eNOS-derived NO synthesis and vasodilation in mice.
21803870 2011 Caveolin-1 in cytokine-induced enhancement of intracellular Ca(2+) in human airway smooth muscle.
21789897 2011 Significant association of caveolin-1 genotypes with bladder cancer susceptibility in Taiwan.
21761200 2011 Caveolin-1 sensitizes cisplatin-induced lung cancer cell apoptosis via superoxide anion-dependent mechanism.
21729786 2011 Biomechanical remodeling of the microenvironment by stromal caveolin-1 favors tumor invasion and metastasis.
21715681 2011 Response of chondrocytes to shear stress: antagonistic effects of the binding partners Toll-like receptor 4 and caveolin-1.
21690289 2011 The Ras inhibitors caveolin-1 and docking protein 1 activate peroxisome proliferator-activated receptor ? through spatial relocalization at helix 7 of its ligand-binding domain.
21683457 2011 The human caveolin 1 gene upstream purine complex and neurodegeneration--a common signature.
21613355 2011 Variants of the caveolin-1 gene: a translational investigation linking insulin resistance and hypertension.
21611203 2011 IGF1R signaling in Ewing sarcoma is shaped by clathrin-/caveolin-dependent endocytosis.
21609392 2011 Identification of telocytes in skeletal muscle interstitium: implication for muscle regeneration.
21585620 2011 Prognostic significance of tumor/stromal caveolin-1 expression in breast cancer patients.
21584795 2011 The impact of caveolin protein expression in tumor stroma on prognosis of breast cancer.
21551225 2011 NFBD1/MDC1 regulates Cav1 and Cav2 independently of DNA damage and p53.
21521946 2011 Molecular profiling of a lethal tumor microenvironment, as defined by stromal caveolin-1 status in breast cancers.
21514437 2011 Transcriptional repression of Caveolin-1 (CAV1) gene expression by GATA-6 in bladder smooth muscle hypertrophy in mice and human beings.
21473727 2011 Caveolin 1 mRNA is overexpressed in malignant renal tissue and might serve as a novel diagnostic marker for renal cancer.
21471610 2011 Caveolin-1 in sarcomas: friend or foe?
21445970 2012 Human melanoma cells express FGFR/Src/Rho signaling that entails an adhesion-independent caveolin-1 membrane association.
21440420 2011 Caveolin 1 inhibits transforming growth factor-?1 activity via inhibition of Smad signaling by hypertrophic scar derived fibroblasts in vitro.
21430048 2011 Caveolin 1 inhibits HIV replication by transcriptional repression mediated through NF-?B.
21423176 2011 Analysis of the myosin-II-responsive focal adhesion proteome reveals a role for ?-Pix in negative regulation of focal adhesion maturation.
21416157 2012 Caveolin-1 is related to invasion, survival, and poor prognosis in hepatocellular cancer.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21382479 2011 Caveolin-1 mediates Fas-BID signaling in hyperoxia-induced apoptosis.
21378366 2011 Significant association of caveolin-1 (CAV1) genotypes with prostate cancer susceptibility in Taiwan.
21373757 2011 Auto-stimulatory action of secreted caveolin-1 on the proliferation of Ewing's sarcoma cells.
21372166 2011 Real-time dynamic movement of caveolin-1 during smooth muscle contraction of human colon and aged rat colon transfected with caveolin-1 cDNA.
21340433 2011 [Extracellular Ca(2+)-sensing receptor-induced extracellular Ca2+ influx is down-regulated by caveolin-1 in human umbilical vein endothelial cells].
21335944 2011 Caveolin-1 may participate in the pathogenesis of bladder pain syndrome/ interstitial cystitis.
21321670 2011 Chromosome 7q31 POAG locus: ocular expression of caveolins and lack of association with POAG in a US cohort.
21302621 Caveolin-1 and VEGF-C promote lymph node metastasis in the absence of intratumoral lymphangiogenesis in non-small cell lung cancer.
21269460 2011 Initial characterization of the human central proteome.
21246406 2011 The association of Caveolin-1 genotypes with oral cancer susceptibility in Taiwan.
21199324 2011 Caveolin-1 is required for contractile phenotype expression by airway smooth muscle cells.
21165568 2011 Differential expression and function of the caveolin-1 gene in non-small cell lung carcinoma.
21152401 2010 IGF-IR internalizes with Caveolin-1 and PTRF/Cavin in HaCat cells.
21148404 2011 Hydrogen peroxide inhibits non-small cell lung cancer cell anoikis through the inhibition of caveolin-1 degradation.
21133631 2010 Mutational profile of the CAV-1 gene in breast cancer cases in the ethnic Kashmiri population.
21109942 2011 Caveolin-1 mediates tumor cell migration and invasion and its regulation by miR-133a in head and neck squamous cell carcinoma.
21106507 2010 Caveolin-1 modulates the ability of Ewing's sarcoma to metastasize.
21098633 2010 Caveolin limits membrane microdomain mobility and integrin-mediated uptake of fibronectin-binding pathogens.
21074769 2011 Leptin upregulates caveolin-1 expression: implications for development of atherosclerosis.
21047970 2011 The Tyro3 receptor kinase Axl enhances macropinocytosis of Zaire ebolavirus.
21041450 2010 Caveolin-1 is ubiquitinated and targeted to intralumenal vesicles in endolysosomes for degradation.
21039037 2010 Caveolin-1 promotes mammary tumorigenesis: mutational profile of the Kashmiri population.
20977883 2010 Caveolin-1 inhibits TrkA-induced cell death by influencing on TrkA modification associated with tyrosine-490 phosphorylation.
20940300 2010 Integrin {alpha}1{beta}1 promotes caveolin-1 dephosphorylation by activating T cell protein-tyrosine phosphatase.
20923773 2010 Regulation of lung cancer cell migration and invasion by reactive oxygen species and caveolin-1.
20881564 2010 Global gene expression profiling and tissue microarray reveal novel candidate genes and down-regulation of the tumor suppressor gene CAV1 in sporadic vestibular schwannomas.
20855565 2010 Common genetic variation in multiple metabolic pathways influences susceptibility to low HDL-cholesterol and coronary heart disease.
20842066 2010 Regulator of G-protein signaling 14 protein modulates Ca²+ influx through Cav1 channels.
20835266 2010 Caveolae and caveolin-1 mediate endocytosis and transcytosis of oxidized low density lipoprotein in endothelial cells.
20835238 2010 Common variants near CAV1 and CAV2 are associated with primary open-angle glaucoma.
20826780 2010 Factor X/Xa elicits protective signaling responses in endothelial cells directly via PAR-2 and indirectly via endothelial protein C receptor-dependent recruitment of PAR-1.
20819778 2010 MicroRNA-related genetic variations as predictors for risk of second primary tumor and/or recurrence in patients with early-stage head and neck cancer.
20819483 2010 [Analysis of the relationship between expression of caveolin-1 and prognosis in bladder transitional cell carcinoma].
20810358 2010 Silencing vascular smooth muscle ATP-sensitive K+ channels with caveolin-1.
20736308 2010 beta-Dystroglycan binds caveolin-1 in smooth muscle: a functional role in caveolae distribution and Ca2+ release.
20729193 2010 The role of proline in the membrane re-entrant helix of caveolin-1.
20700465 2010 Involvement of Caveolin-1 in repair of DNA damage through both homologous recombination and non-homologous end joining.
20682791 2010 A protein interaction network for Ecm29 links the 26 S proteasome to molecular motors and endosomal components.
20646460 2010 [Expression of caveolin-1 and extracellular matrix induced by transforming growth factor beta1 in human fetal lung fibroblasts].
20629037 2010 SR-BI, CD36, and caveolin-1 contribute positively to cholesterol efflux in hepatic cells.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20624795 2010 Interaction with caveolin-1 modulates vascular ATP-sensitive potassium (KATP) channel activity.
20610713 2010 HIV infection upregulates caveolin 1 expression to restrict virus production.
20605793 2010 Involvement of caveolin in low K+-induced endocytic degradation of cell-surface human ether-a-go-go-related gene (hERG) channels.
20581046 2010 Absence of the caveolin-1 P132L mutation in cancers of the breast and other organs.
20558341 2010 Expression of caveolin-1 in tongue squamous cell carcinoma by quantum dots.
20543983 2010 Proinflammatory phenotype and increased caveolin-1 in alveolar macrophages with silenced CFTR mRNA.
20463894 2010 Downregulation of caveolin-1 enhances fusion of human BeWo choriocarcinoma cells.
20427576 2010 Caveolin-1 induces formation of membrane tubules that sense actomyosin tension and are inhibited by polymerase I and transcript release factor/cavin-1.
20411337 2011 RNA inference-mediated caveolin-1 down-regulation decrease estrogen receptor alpha (ER?) signaling in human mammary epithelial cells.
20395445 2010 Pathologic caveolin-1 regulation of PTEN in idiopathic pulmonary fibrosis.
20392844 2010 Caveolin-1 modulates HIV-1 envelope-induced bystander apoptosis through gp41.
20374325 2009 Angiogenic growth factors inhibit chondrocyte ageing in osteoarthritis: potential involvement of catabolic stress-induced overexpression of caveolin-1 in cellular ageing.
20371787 2010 Association of caveolin-1 gene polymorphism with kidney transplant fibrosis and allograft failure.
20346360 2010 Genetic risk factors for hepatopulmonary syndrome in patients with advanced liver disease.
20345844 2011 Decreased caveolin-1 levels contribute to fibrosis and deposition of extracellular IGFBP-5.
20209490 2010 Association of caveolin-1 and -2 genetic variants and post-treatment serum caveolin-1 with prostate cancer risk and outcomes.
20187291 2009 TRPC1 is regulated by caveolin-1 and is involved in oxidized LDL-induced apoptosis of vascular smooth muscle cells.
20153318 2010 Caveolin-1 mutants P132L and Y14F are dominant negative regulators of invasion, migration and aggregation in H1299 lung cancer cells.
20127227 2010 Overexpression of caveolin-1 in lymphoblastoid TK6 cells enhances proliferation after irradiation with clinically relevant doses.
20122998 2010 The role of prostacyclin synthase and thromboxane synthase signaling in the development and progression of cancer.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
20062063 2010 Several common variants modulate heart rate, PR interval and QRS duration.
20062060 2010 Genome-wide association study of PR interval.
20031158 2010 Caveolin-1 regulating the invasion and expression of matrix metalloproteinase (MMPs) in pancreatic carcinoma cells.
20021823 2009 [Over-expression of caveolin-1 inhibits proliferation and invasion of pancreatic carcinoma cells in vitro].
19965594 2010 Lipid droplet analysis in caveolin-deficient adipocytes: alterations in surface phospholipid composition and maturation defects.
19960513 2010 Caveolin-1 facilitates cyclooxygenase-2 protein degradation.
19948975 2009 Integrative predictive model of coronary artery calcification in atherosclerosis.
19931615 2010 MLC1 trafficking and membrane expression in astrocytes: role of caveolin-1 and phosphorylation.
19930645 2009 Disruption of the maxi-K-caveolin-1 interaction alters current expression in human myometrial cells.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19897728 2009 Activation of TRPC1 by STIM1 in ER-PM microdomains involves release of the channel from its scaffold caveolin-1.
19893453 2009 Caveolin-1 acts as a tumor suppressor by down-regulating epidermal growth factor receptor-mitogen-activated protein kinase signaling pathway in pancreatic carcinoma cell lines.
19887621 2009 Lipid rafts and caveolin-1 are required for invadopodia formation and extracellular matrix degradation by human breast cancer cells.
19846513 2010 Hepatitis B virus requires intact caveolin-1 function for productive infection in HepaRG cells.
19828204 2009 Skew in the human caveolin 1 gene upstream purine complex homozygote haplotype compartment in multiple sclerosis.
19820694 2009 Inhibition of thioredoxin reductase 1 by caveolin 1 promotes stress-induced premature senescence.
19816600 2009 Apoptosis of lens epithelial cells induced by high concentration of glucose is associated with a decrease in caveolin-1 levels.
19801678 2009 Lipid rafts and caveolin-1 coordinate interleukin-1beta (IL-1beta)-dependent activation of NFkappaB by controlling endocytosis of Nox2 and IL-1beta receptor 1 from the plasma membrane.
19787257 2009 Synergistic effects of lovastatin and celecoxib on caveolin-1 and its down-stream signaling molecules: Implications for colon cancer prevention.
19767411 2009 Deletion of caveolin-1 protects hyperoxia-induced apoptosis via survivin-mediated pathways.
19759399 2010 GM3 synthase overexpression results in reduced cell motility and in caveolin-1 upregulation in human ovarian carcinoma cells.
19718715 2009 Caveolin-1 is an important factor for the metastasis and proliferation of human small cell lung cancer NCI-H446 cell.
19718657 2009 Expression of caveolin-1 in hepatic cells increases oxidized LDL uptake and preserves the expression of lipoprotein receptors.
19716156 2009 Caveolin-1 expression in diffuse gliomas: correlation with the proliferation index, epidermal growth factor receptor, p53, and 1p/19q status.
19706615 2009 Nitric oxide regulates lung carcinoma cell anoikis through inhibition of ubiquitin-proteasomal degradation of caveolin-1.
19692168 2010 Genetic susceptibility to distinct bladder cancer subphenotypes.
19679565 2009 The DNA methylome of pediatric acute lymphoblastic leukemia.
19641024 2009 Caveolae mediate growth factor-induced disassembly of adherens junctions to support tumor cell dissociation.
19625176 2009 PTEN identified as important risk factor of chronic obstructive pulmonary disease.
19620302 2009 Caveolae facilitate but are not essential for platelet-activating factor-mediated calcium mobilization and extracellular signal-regulated kinase activation.
19614763 2009 Caveolin-1 expression in lung carcinoma varies according to tumour histotype and is acquired de novo in brain metastases.
19614762 2009 Caveolin-1 is a novel immunohistochemical marker to differentiate epithelioid mesothelioma from lung adenocarcinoma.
19609943 2010 Caveolin-1 promotes resistance to chemotherapy-induced apoptosis in Ewing's sarcoma cells by modulating PKCalpha phosphorylation.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19582878 2009 Upregulation of caveolin-1 and CD147 expression in nasopharyngeal carcinoma enhanced tumor cell migration and correlated with poor prognosis of the patients.
19581923 2010 The role of caveolin-1 in prostate cancer: clinical implications.
19556867 2009 An absence of stromal caveolin-1 is associated with advanced prostate cancer, metastatic disease and epithelial Akt activation.
19521982 2009 Caveolin-1 tumor-promoting role in human melanoma.
19499152 2009 Binding of IFITM1 enhances the inhibiting effect of caveolin-1 on ERK activation.
19494002 2009 Human papillomavirus type 16 infection of human keratinocytes requires clathrin and caveolin-1 and is brefeldin a sensitive.
19487814 2009 Persistent eNOS activation secondary to caveolin-1 deficiency induces pulmonary hypertension in mice and humans through PKG nitration.
19483462 2009 Caveolin-1 regulates EGFR signaling in MCF-7 breast cancer cells and enhances gefitinib-induced tumor cell inhibition.
19483189 2009 Increased PEA3/E1AF and decreased Net/Elk-3, both ETS proteins, characterize human NSCLC progression and regulate caveolin-1 transcription in Calu-1 and NCI-H23 NSCLC cell lines.
19477952 2009 Compartmentalizing VEGF-induced ERK2/1 signaling in placental artery endothelial cell caveolae: a paradoxical role of caveolin-1 in placental angiogenesis in vitro.
19475601 2010 Novel extreme homozygote haplotypes at the human caveolin 1 gene upstream purine complex in sporadic Alzheimer's disease.
19434519 2009 Overexpression of caveolin-1 in hepatocellular carcinoma with metastasis and worse prognosis: correlation with vascular endothelial growth factor, microvessel density and unpaired artery.
19411449 2009 Stromal cell expression of caveolin-1 predicts outcome in breast cancer.
19411448 2009 An absence of stromal caveolin-1 expression predicts early tumor recurrence and poor clinical outcome in human breast cancers.
19395651 2009 Caveolin-1 (P132L), a common breast cancer mutation, confers mammary cell invasiveness and defines a novel stem cell/metastasis-associated gene signature.
19386787 2009 Cystic fibrosis transmembrane conductance regulator and caveolin-1 regulate epithelial cell internalization of Pseudomonas aeruginosa.
19381331 2009 High levels of exosomes expressing CD63 and caveolin-1 in plasma of melanoma patients.
19369293 2009 Caveolin-1 directly interacts with UT-A1 urea transporter: the role of caveolae/lipid rafts in UT-A1 regulation at the cell membrane.
19369195 2009 Large-scale proteomics analysis of the human kinome.
19342880 2009 Using Caveolin-1 epithelial immunostaining patterns to stratify human breast cancer patients and predict the Caveolin-1 (P132L) mutation.
19288272 2010 Growth of hormone-dependent MCF-7 breast cancer cells is promoted by constitutive caveolin-1 whose expression is lost in an EGF-R-mediated manner during development of tamoxifen resistance.
19286607 2009 Akt-mediated transactivation of the S1P1 receptor in caveolin-enriched microdomains regulates endothelial barrier enhancement by oxidized phospholipids.
19250636 2009 IGF-I induced rapid recruitment of integrin beta1 to lipid rafts is Caveolin-1 dependent.
19244345 2009 Caveolin-1-mediated suppression of cyclooxygenase-2 via a beta-catenin-Tcf/Lef-dependent transcriptional mechanism reduced prostaglandin E2 production and survivin expression.
19234134 2009 Caveolin-1-/- null mammary stromal fibroblasts share characteristics with human breast cancer-associated fibroblasts.
19219452 2009 Caveolin, GLUT4 and insulin receptor protein content in human arm and leg muscles.
19170196 2009 Polymorphisms in innate immunity genes and lung cancer risk in Xuanwei, China.
19160064 2009 Caveolin-1 overexpression correlates with tumour progression markers in pancreatic ductal adenocarcinoma.
19123976 2008 Caveolin-1 inhibits membrane-type 1 matrix metalloproteinase activity.
19121286 2009 Flotillin-1 stabilizes caveolin-1 in intestinal epithelial cells.
19116988 2009 Identification of extracellular delta-catenin accumulation for prostate cancer detection.
19104007 2009 Guanosine triphosphate cyclohydrolase I expression and enzymatic activity are present in caveolae of endothelial cells.
19061949 2009 Promotion of autophagy and inhibition of apoptosis by low concentrations of cadmium in vascular endothelial cells.
19059381 2009 Interaction of the immunoglobulin-like cell adhesion molecule hepaCAM with caveolin-1.
19052258 2009 Caveolin-1 scaffold domain interacts with TRPC1 and IP3R3 to regulate Ca2+ store release-induced Ca2+ entry in endothelial cells.
19038362 2009 Filling up adipocytes with lipids. Lessons from caveolin-1 deficiency.
19032226 2008 Caveolin-1 expression is a distinct feature of chronic rejection-induced transplant capillaropathy.
19015640 2009 Disruption of xCT inhibits cancer cell metastasis via the caveolin-1/beta-catenin pathway.
19002697 2009 Patients with long bone fracture have altered Caveolin-1 expression in their peripheral blood mononuclear cells.
19002186 2008 Restoration of caveolin-1 expression suppresses growth and metastasis of head and neck squamous cell carcinoma.
18992712 2009 Caveolin-1 negatively regulates TRAIL-induced apoptosis in human hepatocarcinoma cells.
18992284 2009 Caveolin-1 regulates glioblastoma aggressiveness through the control of alpha(5)beta(1) integrin expression and modulates glioblastoma responsiveness to SJ749, an alpha(5)beta(1) integrin antagonist.
18985008 2008 Co-localization and interaction of human organic anion transporter 4 with caveolin-1 in primary cultured human placental trophoblasts.
18957516 2008 A dual role for caveolin-1 in the regulation of fibronectin matrix assembly by uPAR.
18936967 2008 Caveolin-1 immuno-expression in human gastric cancer: histopathogenetic hypotheses.
18923542 2008 The regulation of the cardiac potassium channel (HERG) by caveolin-1.
18922892 2008 Phosphorylated caveolin-1 regulates Rho/ROCK-dependent focal adhesion dynamics and tumor cell migration and invasion.
18836420 2009 Caveolin-1 expression in human breast lobular cancer progression.
18802406 2008 Co-expression of fatty acid synthase and caveolin-1 in pancreatic ductal adenocarcinoma: implications for tumor progression and clinical outcome.
18793348 2008 Freeze-fracture replica immunolabelling reveals caveolin-1 in the human cardiomyocyte plasma membrane.
18789131 2008 Radiation-induced caveolin-1 associated EGFR internalization is linked with nuclear EGFR transport and activation of DNA-PK.
18759267 2008 Decreased expression of caveolin 1 in patients with systemic sclerosis: crucial role in the pathogenesis of tissue fibrosis.
18698612 2008 Novel subtype of congenital generalized lipodystrophy associated with muscular weakness and cervical spine instability.
18681962 2008 Caveolin-1 expression and stress-induced premature senescence in human intervertebral disc degeneration.
18676680 2008 Pathway-based evaluation of 380 candidate genes and lung cancer susceptibility suggests the importance of the cell cycle pathway.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18667611 2008 Caveolin-1 regulates human immunodeficiency virus-1 Tat-induced alterations of tight junction protein expression via modulation of the Ras signaling.
18667513 2008 Caveolin-1-dependent infectious entry of human papillomavirus type 31 in human keratinocytes proceeds to the endosomal pathway for pH-dependent uncoating.
18635971 2008 Caveolin-1 interacts with a lipid raft-associated population of fatty acid synthase.
18598695 2008 Filamin A is a novel caveolin-1-dependent target in IGF-I-stimulated cancer cell migration.
18596970 2008 Caveolin-1 influences vascular protease activity and is a potential stabilizing factor in human atherosclerotic disease.
18561140 2009 A novel polymorphic purine complex at the 1.5 kb upstream region of the human caveolin-1 gene and risk of Alzheimer's disease; extra-short alleles and accumulated allele homozygosity.
18543249 2008 IL-6/sIL-6R enhances cathepsin B and L production via caveolin-1-mediated JNK-AP-1 pathway in human gingival fibroblasts.
18510854 2008 [Role of caveolin-1 down-regulation by iRNA in human hepatocyte proliferation].
18458534 2008 Human breast cancer-associated fibroblasts (CAFs) show caveolin-1 downregulation and RB tumor suppressor functional inactivation: Implications for the response to hormonal therapy.
18444242 2008 Wild-type APC regulates caveolin-1 expression in human colon adenocarcinoma cell lines via FOXO1a and C-myc.
18439424 2008 Increased abundance of cytoplasmic and nuclear caveolin 1 in human diploid fibroblasts in H(2)O(2)-induced premature senescence and interplay with p38alpha(MAPK).
18437015 2008 Impact of caveolin-1 expression on the prognosis of transitional cell carcinoma of the upper urinary tract.
18434090 2008 Caveolin-1 increases basal and TGF-beta1-induced expression of type I procollagen through PI-3 kinase/Akt/mTOR pathway in human dermal fibroblasts.
18406871 2008 Expression changes of CAV1 and EZH2, located on 7q31 approximately q36, are rarely related to genomic alterations in primary prostate carcinoma.
18332144 2008 Caveolin-1 up-regulation during epithelial to mesenchymal transition is mediated by focal adhesion kinase.
18312604 2008 Colocalization of androgen binding protein, oxytocin receptor, caveolin 1 and proliferation marker p21 in benign prostate hyperplasia.
18308897 2008 Caveolin mediates rapid glucocorticoid effects and couples glucocorticoid action to the antiproliferative program.
18301242 2008 Immunohistochemical evidence of caveolin-1 expression in the human fetal and neonatal striated muscle and absence in the adult's.
18300018 2008 Caveolin-1: a tumor-promoting role in human cancer.
18296864 2008 Caveolae/caveolin-1 are important modulators of store-operated calcium entry in Hs578/T breast cancer cells.
18282163 2008 Correlative evidence that tumor cell-derived caveolin-1 mediates angiogenesis in meningiomas.
18258603 2008 Interactions of acetylcholinesterase with caveolin-1 and subsequently with cytochrome c are required for apoptosome formation.
18245088 2008 Annexin A6-induced inhibition of cytoplasmic phospholipase A2 is linked to caveolin-1 export from the Golgi.
18237401 2008 Heterozygous CAV1 frameshift mutations (MIM 601047) in patients with atypical partial lipodystrophy and hypertriglyceridemia.
18211975 2008 Association of a homozygous nonsense caveolin-1 mutation with Berardinelli-Seip congenital lipodystrophy.
18203815 2008 Antifibrotic properties of caveolin-1 scaffolding domain in vitro and in vivo.
18180853 2008 Preliminary computational modeling of nitric oxide synthase 3 interactions with caveolin-1: influence of exon 7 Glu298Asp polymorphism.
18162583 2008 Caveolin-1 and -2 interact with connexin43 and regulate gap junctional intercellular communication in keratinocytes.
18081315 2008 Serine 23 and 36 phosphorylation of caveolin-2 is differentially regulated by targeting to lipid raft/caveolae and in mitotic endothelial cells.
18065769 2008 Caveolin-1 interacts and cooperates with the transforming growth factor-beta type I receptor ALK1 in endothelial caveolae.
18054388 2008 The immunogenic CBD1 peptide corresponding to the caveolin-1 binding domain in HIV-1 envelope gp41 has the capacity to penetrate the cell membrane and bind caveolin-1.
18053095 Caveolin-1 is transported to multi-vesicular bodies after albumin-induced endocytosis of caveolae in HepG2 cells.
17982011 2008 Caveolin-1 and caveolin-3 form heterooligomeric complexes in atrial cardiac myocytes that are required for doxorubicin-induced apoptosis.
17952758 2008 Expression of sex hormone-binding globulin, oxytocin receptor, caveolin-1 and p21 in leiomyoma.
17942630 2007 Effect of caveolin-1 scaffolding peptide and 17beta-estradiol on intracellular Ca2+ kinetics evoked by angiotensin II in human vascular smooth muscle cells.
17936759 2007 Caveolin-1 affects serotonin binding and cell surface levels of human 5-HT7(a) receptors.
17935714 2007 Abrogation of p53 by its antisense in MCF-7 breast carcinoma cells increases cyclin D1 via activation of Akt and promotion of cell proliferation.
17933968 2007 The role of caveolin-1 in PCB77-induced eNOS phosphorylation in human-derived endothelial cells.
17906498 2007 Caveolin-1 inhibits the growth of human laryngeal squamous cell carcinoma and down regulates EGFR-MAPKs signaling pathway.
17898556 2007 [Expression of caveolin in hepatocellular carcinoma: association with unpaired artery formation and radiologic findings].
17855368 2007 Identification of a novel inhibitor of differentiation-1 (ID-1) binding partner, caveolin-1, and its role in epithelial-mesenchymal transition and resistance to apoptosis in prostate cancer cells.
17851687 2007 COX-2 localization within plasma membrane caveolae-like structures in human lobular intraepithelial neoplasia of the breast.
17850762 2007 Aromatic residues of Caveolin-1 binding motif of alpha-hemolysin are essential for membrane penetration.
17848177 2007 Tissue factor induction by protease-activated receptor 1 requires intact caveolin-enriched membrane microdomains in human endothelial cells.
17803693 2008 Expression of caveolin-1 in human adipose tissue is upregulated in obesity and obesity-associated type 2 diabetes mellitus and related to inflammation.
17786288 2007 High frequency of promoter methylation of the 14-3-3 sigma and CAGE-1 genes, but lack of hypermethylation of the caveolin-1 gene, in primary adenocarcinomas and signet ring cell carcinomas of the urinary bladder.
17785436 2007 E-cadherin is required for caveolin-1-mediated down-regulation of the inhibitor of apoptosis protein survivin via reduced beta-catenin-Tcf/Lef-dependent transcription.
17713785 2007 Evidence for a role of caveolin-1 in neurokinin-1 receptor plasma-membrane localization, efficient signaling, and interaction with beta-arrestin 2.
17707459 2007 Correlative evidence that prostate cancer cell-derived caveolin-1 mediates angiogenesis.
17699771 2007 Caveolin-1 reduces osteosarcoma metastases by inhibiting c-Src activity and met signaling.
17671707 2007 The overexpression of caveolin-1 and caveolin-2 correlates with a poor prognosis and tumor progression in esophageal squamous cell carcinoma.
17662641 2007 Downregulation of caveolin-1 affects bleomycin-induced growth arrest and cellular senescence in A549 cells.
17626097 2007 Human papillomavirus type 31 uses a caveolin 1- and dynamin 2-mediated entry pathway for infection of human keratinocytes.
17615539 2007 Different caveolin isoforms in the retina of melanoma malignum affected human eye.
17609206 2007 The tetraspan protein EMP2 regulates expression of caveolin-1.
17594718 2007 Differential expression of caveolin-1 in renal neoplasms.
17556531 2007 Association of estrogen receptor beta with plasma-membrane caveola components: implication in control of vitamin D receptor.
17537407 2007 Cell selective glucocorticoid induction of caveolin-1 and caveolae in differentiating pulmonary alveolar epithelial cell cultures.
17478448 2007 Loss of caveolin-1 in bronchiolization in lung fibrosis.
17460461 2007 Caveolin-1 expression is variably displayed in astroglial-derived tumors and absent in oligodendrogliomas: concrete premises for a new reliable diagnostic marker in gliomas.
17379346 2007 Rotavirus NSP4 interacts with both the amino- and carboxyl-termini of caveolin-1.
17359972 2007 Binding of nuclear caveolin-1 to promoter elements of growth-associated genes in ovarian carcinoma cells.
17341888 2006 Methylation status of genes upregulated by demethylating agent 5-aza-2'-deoxycytidine in hepatocellular carcinoma.
17334644 2007 Association of gene polymorphisms with blood pressure and the prevalence of hypertension in community-dwelling Japanese individuals.
17314510 2007 Caveolin-1 and liver regeneration: role in proliferation and lipogenesis.
17299799 2007 Caveolin-1 overexpression is associated with aggressive prostate cancer recurrence.
17287217 2007 Caveolin-1 triggers T-cell activation via CD26 in association with CARMA1.
17284246 2007 Overexpression of caveolin-1 in a human melanoma cell line results in dispersion of ganglioside GD3 from lipid rafts and alteration of leading edges, leading to attenuation of malignant properties.
17272740 2007 Mechanisms of cardiac protection from ischemia/reperfusion injury: a role for caveolae and caveolin-1.
17245131 2007 Overexpression of caveolin-1 inhibits endothelial cell proliferation by arresting the cell cycle at G0/G1 phase.
17237399 2007 Effects of vascular endothelial growth factor on the lymphocyte-endothelium interactions: identification of caveolin-1 and nitric oxide as control points of endothelial cell anergy.
17202321 2007 Reciprocal negative regulation between thyrotropin/3',5'-cyclic adenosine monophosphate-mediated proliferation and caveolin-1 expression in human and murine thyrocytes.
17200343 2007 Caveolin 1 is overexpressed and amplified in a subset of basal-like and metaplastic breast carcinomas: a morphologic, ultrastructural, immunohistochemical, and in situ hybridization analysis.
17197700 2007 Identification of the HIV-1 gp41 core-binding motif in the scaffolding domain of caveolin-1.
17192395 2007 Comparative gene expression profiling of in vitro differentiated megakaryocytes and erythroblasts identifies novel activatory and inhibitory platelet membrane proteins.
17190831 2007 Caveolin-1 tyrosine phosphorylation enhances paclitaxel-mediated cytotoxicity.
17179151 2007 Activated epidermal growth factor receptor induces integrin alpha2 internalization via caveolae/raft-dependent endocytic pathway.
17178917 2006 Caveolin-1: a critical regulator of lung fibrosis in idiopathic pulmonary fibrosis.
17111160 2007 Renal caveolin-1 expression in children with unilateral ureteropelvic junction obstruction.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
17047056 2006 Caveolin-1 (CAV1) is a target of EWS/FLI-1 and a key determinant of the oncogenic phenotype and tumorigenicity of Ewing's sarcoma cells.
17014845 2006 Caveolin-1 up-regulates IGF-I receptor gene transcription in breast cancer cells via Sp1- and p53-dependent pathways.
17010968 2006 The shedding activity of ADAM17 is sequestered in lipid rafts.
16979166 2006 Caveolin-1 controls BRCA1 gene expression and cellular localization in human breast cancer cells.
16951145 2006 Interaction of deleted in liver cancer 1 with tensin2 in caveolae and implications in tumor suppression.
16931572 2006 Caveolin-1 regulates cellular trafficking and function of the glucagon-like Peptide 1 receptor.
16920641 Caveolin-1 immuno-expression in human fetal tissues during mid and late gestation.
16904002 2006 Caveolin-1 and -2 in airway epithelium: expression and in situ association as detected by FRET-CLSM.
16897435 2006 Albumin-bound paclitaxel, ABI-007 may show better efficacy than paclitaxel in basal-like breast cancers: association between caveolin-1 expression and ABI-007.
16890161 2006 Caveolin is necessary for Wnt-3a-dependent internalization of LRP6 and accumulation of beta-catenin.
16877379 2006 A functional interaction between sprouty proteins and caveolin-1.
16870193 2007 Sustained elevations in NEFA induce cyclooxygenase-2 activity and potentiate THP-1 macrophage foam cell formation.
16857240 2006 Caveolin-1 inhibits anoikis and promotes survival signaling in cancer cells.
16850311 2006 Caveolin-1 in meningiomas: expression and clinico-pathological correlations.
16822931 2006 Caveolin-1 regulates store-operated Ca2+ influx by binding of its scaffolding domain to transient receptor potential channel-1 in endothelial cells.
16820915 2006 Genetic analysis of caveolin-1 and eNOS genes in colorectal cancer.
16807357 2006 Translocation of endothelial nitric-oxide synthase involves a ternary complex with caveolin-1 and NOSTRIN.
16799092 2006 Dynamic profiling of the post-translational modifications and interaction partners of epidermal growth factor receptor signaling after stimulation by epidermal growth factor using Extended Range Proteomic Analysis (ERPA).
16790997 2006 Caveolin-1 is associated with VCAM-1 dependent adhesion of gastric cancer cells to endothelial cells.
16723714 2006 Caveolin-1 mutations in human breast cancer: functional association with estrogen receptor alpha-positive status.
16722822 2006 Subcellular targeting and trafficking of nitric oxide synthases.
16713605 Association of prostate-specific membrane antigen with caveolin-1 and its caveolae-dependent internalization in microvascular endothelial cells: implications for targeting to tumor vasculature.
16617096 2006 Role of caveolin-1 in p42/p44 MAP kinase activation and proliferation of human airway smooth muscle.
16616146 2007 Effects of homocysteine on the levels of caveolin-1 and eNOS in caveolae of human coronary artery endothelial cells.
16608879 2006 Caveolin-1 controls cell proliferation and cell death by suppressing expression of the inhibitor of apoptosis protein survivin.
16601841 2006 Genetic analysis of CAV1 gene in hypertension and metabolic syndrome.
16601146 2006 Caveolae and cell swelling. Focus on "Stimulation by caveolin-1 of the hypotonicity-induced release of taurine and ATP at basolateral, but not apical, membrane of Caco-2 cells".
16541313 2006 Caveolin-1 expression is associated with a basal-like phenotype in sporadic and hereditary breast cancer.
16501093 2006 The rotavirus enterotoxin NSP4 directly interacts with the caveolar structural protein caveolin-1.
16480767 Caveolin-1 and lipid rafts in confluent BeWo trophoblasts: evidence for Rock-1 association with caveolin-1.
16443388 2006 Opposite effect of caveolin-1 in the metabolism of high-density and low-density lipoproteins.
16407214 2006 Epidermal growth factor receptor exposed to oxidative stress undergoes Src- and caveolin-1-dependent perinuclear trafficking.
16405917 2006 Neurofibromin binds to caveolin-1 and regulates ras, FAK, and Akt.
16388599 2006 Identification of phosphocaveolin-1 as a novel protein tyrosine phosphatase 1B substrate.
16381901 2006 The LIFEdb database in 2006.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16338968 2006 Stimulation by caveolin-1 of the hypotonicity-induced release of taurine and ATP at basolateral, but not apical, membrane of Caco-2 cells.
16332692 2006 Epithelial growth factor-induced phosphorylation of caveolin 1 at tyrosine 14 stimulates caveolae formation in epithelial cells.
16328005 2006 Transitional cell carcinomas and nonurothelial carcinomas of the urinary bladder differ in the promoter methylation status of the caveolin-1, hDAB2IP and p53 genes, but not in the global methylation of Alu elements.
16324201 2005 Caveolin-1 is down-regulated and inversely correlated with HER2 and EGFR expression status in invasive ductal carcinoma of the breast.
16263077 2005 Structural insights into the function of human caveolin 1.
16251425 2005 Simultaneous expression of caveolin-1 and E-cadherin in ovarian carcinoma cells stabilizes adherens junctions through inhibition of src-related kinases.
16244790 2006 Overexpression of caveolin-1 and -2 in cell lines and in human samples of inflammatory breast cancer.
16225848 2005 Insulin and IGF-I phosphorylate eNOS in HUVECs by a caveolin-1 dependent mechanism.
16202996 2006 Expression of caveolin-1 is correlated with Akt-1 in colorectal cancer tissues.
15969750 2005 Regulation of pancreatic cancer cell migration and invasion by RhoC GTPase and caveolin-1.
15968725 2005 High expressions of caveolins on the proliferating bile ductules in primary biliary cirrhosis.
15958730 2005 Tyrosine phosphorylation of caveolin 1 by oxidative stress is reversible and dependent on the c-src tyrosine kinase but not mitogen-activated protein kinase pathways in placental artery endothelial cells.
15951569 2005 Time-resolved mass spectrometry of tyrosine phosphorylation sites in the epidermal growth factor receptor signaling network reveals dynamic modules.
15948133 2005 Association of a CAV-1 haplotype to familial aggressive prostate cancer.
15817451 2005 Caveolin-1 enhances tissue factor pathway inhibitor exposure and function on the cell surface.
15811424 2005 Increased caveolin-1, a cause for the declined adipogenic potential of senescent human mesenchymal stem cells.
15769846 2005 Caveolin-1 mediates the expression and localization of cathepsin B, pro-urokinase plasminogen activator and their cell-surface receptors in human colorectal carcinoma cells.
15722199 2005 The subcellular localization control of integrin linked kinase 1 through its protein-protein interaction with caveolin-1.
15703204 2005 Maxi-K channels localize to caveolae in human myometrium: a role for an actin-channel-caveolin complex in the regulation of myometrial smooth muscle K+ current.
15691837 2005 Opposing effects of protein kinase Calpha and protein kinase Cepsilon on collagen expression by human lung fibroblasts are mediated via MEK/ERK and caveolin-1 signaling.
15665033 2005 Expression of caveolin-1 in lymphocytes induces caveolae formation and recruitment of phosphofructokinase to the plasma membrane.
15657086 2005 Dynamics and interaction of caveolin-1 isoforms with BMP-receptors.
15657067 2005 Phosphotyrosine signaling networks in epidermal growth factor receptor overexpressing squamous carcinoma cells.
15592498 2005 Caveolin-1 inhibits cell detachment-induced p53 activation and anoikis by upregulation of insulin-like growth factor-I receptors and signaling.
15592455 2005 Immunoaffinity profiling of tyrosine phosphorylation in cancer cells.
15590415 Co-localization of P2Y1 receptor and NTPDase1/CD39 within caveolae in human placenta.
15531587 2005 KLF11-mediated repression antagonizes Sp1/sterol-responsive element-binding protein-induced transcriptional activation of caveolin-1 in response to cholesterol signaling.
15504729 2005 Loss of caveolin-1 polarity impedes endothelial cell polarization and directional movement.
15498565 2004 Suppression of P-glycoprotein gene expression in Hs578T/Dox by the overexpression of caveolin-1.
15496150 2004 Caveolin-1 in mesangial cells suppresses MAP kinase activation and cell proliferation induced by bFGF and PDGF.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15485672 2004 Functional form of Caveolin-1 is necessary for the assembly of alpha-hemolysin.
15485671 2004 Assembly of alpha-hemolysin on A431 cells leads to clustering of Caveolin-1.
15466889 2004 Caveolin-1 and MAL are located on prostasomes secreted by the prostate cancer PC-3 cell line.
15466865 2004 Src-mediated tyrosine phosphorylation of caveolin-1 induces its association with membrane type 1 matrix metalloproteinase.
15458387 2005 Direct control of caveolin-1 expression by FOXO transcription factors.
15375584 2004 Mutational, epigenetic and expressional analyses of caveolin-1 gene in breast cancers.
15353589 2004 CD26 up-regulates expression of CD86 on antigen-presenting cells by means of caveolin-1.
15334058 2004 Caveolin-1 inhibits breast cancer growth and metastasis.
15314095 2004 Rosiglitazone upregulates caveolin-1 expression in THP-1 cells through a PPAR-dependent mechanism.
15274335 Promoter CpG methylation of caveolin-1 in sporadic colorectal cancer.
15263006 2004 Morphological adjustment of senescent cells by modulating caveolin-1 status.
15242332 2004 Vectorial proteomics reveal targeting, phosphorylation and specific fragmentation of polymerase I and transcript release factor (PTRF) at the surface of caveolae in human adipocytes.
15240128 2004 Overexpression of caveolin-1 increases plasma membrane fluidity and reduces P-glycoprotein function in Hs578T/Dox.
15234575 2004 Caveolin-1 gene is coordinately regulated with the multidrug resistance 1 gene in normal and leukemic bone marrow.
15234566 2004 Caveolin-1 and cancer multidrug resistance: coordinate regulation of pro-survival proteins?
15219854 2004 N-terminal processing and modifications of caveolin-1 in caveolae from human adipocytes.
15205342 2004 Different roles for caveolin-1 in the development of non-small cell lung cancer versus small cell lung cancer.
15201341 2004 Links between CD147 function, glycosylation, and caveolin-1.
15190056 2004 Caveolin-1 interacts with 5-HT2A serotonin receptors and profoundly modulates the signaling of selected Galphaq-coupled protein receptors.
15182174 2004 Sterol carrier protein-2 directly interacts with caveolin-1 in vitro and in vivo.
15069532 2004 Overexpression of caveolin-1 in experimental colon adenocarcinomas and human colon cancer cell lines.
15064242 2004 Nitric oxide modulates caveolin-1 and matrix metalloproteinase-9 expression and distribution at the endothelial cell/tumor cell interface.
15003536 2004 IGF-I regulates caveolin 1 and IRS1 interaction in caveolae.
14981899 Caveolin-1 haploinsufficiency leads to partial transformation of human breast epithelial cells.
14963033 2004 Ouabain assembles signaling cascades through the caveolar Na+/K+-ATPase.
14729661 2004 Expression of caveolin-1 enhances cholesterol efflux in hepatic cells.
14719121 2004 Mutation and aberrant expression of Caveolin-1 in human oral squamous cell carcinomas and oral cancer cell lines.
14707126 2004 Caveolin-1 regulates matrix metalloproteinases-1 induction and CD147/EMMPRIN cell surface clustering.
14706341 2003 Downregulation of caveolin-1 function by EGF leads to the loss of E-cadherin, increased transcriptional activity of beta-catenin, and enhanced tumor cell invasion.
14665433 2004 Functional caveolae are a prerequisite for CD40 signaling in human renal proximal tubule cells.
14660607 2004 Caveolin-1 knockdown by small interfering RNA suppresses responses to the chemokine monocyte chemoattractant protein-1 by human astrocytes.
14645548 2003 Caveolin-1 maintains activated Akt in prostate cancer cells through scaffolding domain binding site interactions with and inhibition of serine/threonine protein phosphatases PP1 and PP2A.
14612902 2003 Caveolin-1 overexpression predicts poor disease-free survival of patients with clinically confined renal cell carcinoma.
14593097 2004 Localization of low density lipoprotein receptor-related protein 1 to caveolae in 3T3-L1 adipocytes in response to insulin treatment.
14576164 2004 Cellular internalization of insulin-like growth factor binding protein-3: distinct endocytic pathways facilitate re-uptake and nuclear localization.
14559243 2003 Association of the calpain/calpastatin network with subcellular organelles.
12888893 2003 Mutational, epigenetic and expressional analyses of caveolin-1 gene in cervical cancers.
12852865 2003 Caveolae and caveolin-1 in human term villous trophoblast.
12816877 2003 Caveolin-1 can regulate vascular smooth muscle cell fate by switching platelet-derived growth factor signaling from a proliferative to an apoptotic pathway.
12813462 2003 Peroxisome proliferator-activated receptor-gamma upregulates caveolin-1 and caveolin-2 expression in human carcinoma cells.
12810205 Caveolin expression in adult renal tumors.
12743374 2003 The phosphorylation of caveolin-2 on serines 23 and 36 modulates caveolin-1-dependent caveolae formation.
12737162 2003 Caveolin-I overexpression is a favourable prognostic factor for patients with extrahepatic bile duct carcinoma.
12732636 2003 Caveolin-1 contributes to assembly of store-operated Ca2+ influx channels by regulating plasma membrane localization of TRPC1.
12730243 2003 Senescent phenotype can be reversed by reduction of caveolin status.
12716887 2003 Caveolin-1 regulates the functional localization of N-acetylglucosaminyltransferase III within the golgi apparatus.
12711000 2003 Functional interaction of estrogen receptor alpha and caveolin isoforms in neuronal SK-N-MC cells.
12694195 2003 Regulated interaction of endothelin B receptor with caveolin-1.
12690205 2003 Human chromosome 7: DNA sequence and biology.
12648214 2003 Caveolin expression and localization in human keratinocytes suggest a role in lamellar granule biogenesis.
12633858 2003 Involvement of caveolin-2 in caveolar biogenesis in MDCK cells.
12606314 2003 Role of caveolae in signal-transducing function of cardiac Na+/K+-ATPase.
12562842 2003 Caveolin-1 does not affect SR-BI-mediated cholesterol efflux or selective uptake of cholesteryl ester in two cell lines.
12531427 2003 c-Abl is required for oxidative stress-induced phosphorylation of caveolin-1 on tyrosine 14.
12529448 2003 Regulation of vascular endothelial growth factor receptor-2 activity by caveolin-1 and plasma membrane cholesterol.
12507501 2003 Aberrantly expressed recoverin is functionally associated with G-protein-coupled receptor kinases in cancer cell lines.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12429840 2002 Localization of phospholipase D1 to caveolin-enriched membrane via palmitoylation: implications for epidermal growth factor signaling.
12414992 2002 The scaffolding domain of caveolin 2 is responsible for its Golgi localization in Caco-2 cells.
12414512 2002 Up-regulated caveolin-1 accentuates the metastasis capability of lung adenocarcinoma by inducing filopodia formation.
12401329 2002 Expression of caveolin-1 in human brain microvessels.
12388746 2002 Caveolin-1-deficient mice show accelerated mammary gland development during pregnancy, premature lactation, and hyperactivation of the Jak-2/STAT5a signaling cascade.