Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.46
PubTator Score 0.58

Knowledge Summary


No data available


  Disease (1)

Disease Target Count P-value
psoriasis 6685 1.3e-54


  Differential Expression (1)

Disease log2 FC p
psoriasis -1.200 1.3e-54

AA Sequence

SGISSMPSLRHSRMGSMFSSRMTEDRAEPKEAVERQLMT                                  1121 - 1159

Text Mined References (6)

PMID Year Title
19516020 2009 A novel, single, transmembrane protein CATSPERG is associated with CATSPER1 channel protein.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15057824 2004 The DNA sequence and biology of human chromosome 19.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.