Property Summary

NCBI Gene PubMed Count 27
PubMed Score 12.98
PubTator Score 48.95

Knowledge Summary

Patent (3,809)

Expression

Gene RIF (18)

PMID Text
26453676 Sperm with a near absence of CatSper current failed to respond to activation of CatSper by progesterone and there was fertilization failure at IVF.
26354096 The role of CATSPER1 in idiopathic asthenospermia pathogenesis: exonal SNP rs1893316 in CATSPER1 significantly correlated with idiopathic asthenospermia risk
25101494 Sox5 and Sox9 cause a significant increase in transactivation of the Catsper1 promoter.
23623968 Progesterone via CatSper activates the PI3K-AKT pathway required for motility and hyperactivation but not for acrosome reaction.
23530196 CatSper is indeed the principal Ca2+ channel of human spermatozoa, and that it is strongly potentiated by progesterone.
23344959 CatSper activation can elicit functionally different behaviors according to the sensitivity of the Ca(2+) store, which may be regulated by capacitation and NO from the cumulus.
23313885 The immediate upstream region and the first exon in the human CATSPER1 gene negatively regulate transcriptional activity.
23313885 This work reports the cloning and characterization of the promoter regions in the human and murine Catsper1 genes. The immediate upstream region and the first exon in the human CATSPER1 gene negatively regulate transcriptional activity. The mouse Catsper1 promoter exhibited transcriptional activity in both orientations and displayed significant expression levels in mouse testis in vivo.
22354039 It was shown that odorants directly activate CatSper without involving G protein-coupled receptors and cAMP. Membrane-permeable analogues of cyclic nucleotides activated CatSper directly via an extracellular site.
21412339 human CatSper is synergistically activated by elevation of intracellular pH and extracellular progesterone
21412338 progesterone activates the sperm-specific, pH-sensitive CatSper Ca(2+) channel
21404705 The decreased or abnormal expression of the CatSper1 protein may be a factor involved in the pathogenesis of idiopathic asthenozoospermia.
20648059 Studies indicate that CATSPER channel represents a novel human male fertility factor.
19344877 sequence analysis of CATSPER1 in heritable forms of nonsyndromic male infertility revealed two separate insertion mutations (c.539-540insT and c.948-949insATGGC) that are predicted to lead to frameshifts and premature stop codons
18976756 CatSper1 may be a potential target for immunocontraception, and the antibody may be a tool to study the function of ion channels in sperm.
16740636 CatSper1 and CatSper2 can associate with and modulate the function of the Ca(v)3.3 channel, which might be important in the regulation of sperm function.
16625279 CATSPER1 is meiotically and post-meiotically expressed in human testis tissue.
14688170 Potential role for CatSper in sperm motility and fertility in mouse and human. CatSper is therefore implicated as a potential target to explore the molecular mechanisms of male infertility.

AA Sequence

MDQNSVPEKAQNEADTNNADRFFRSHSSPPHHRPGHSRALHHYELHHHGVPHQRGESHHPPEFQDFHDQA      1 - 70
LSSHVHQSHHHSEARNHGRAHGPTGFGLAPSQGAVPSHRSYGEDYHDELQRDGRRHHDGSQYGGFHQQSD     71 - 140
SHYHRGSHHGRPQYLGENLSHYSSGVPHHGEASHHGGSYLPHGPNPYSESFHHSEASHLSGLQHDESQHH    141 - 210
QVPHRGWPHHHQVHHHGRSRHHEAHQHGKSPHHGETISPHSSVGSYQRGISDYHSEYHQGDHHPSEYHHG    211 - 280
DHPHHTQHHYHQTHRHRDYHQHQDHHGAYHSSYLHGDYVQSTSQLSIPHTSRSLIHDAPGPAASRTGVFP    281 - 350
YHVAHPRGSAHSMTRSSSTIRSRVTQMSKKVHTQDISTKHSEDWGKEEGQFQKRKTGRLQRTRKKGHSTN    351 - 420
LFQWLWEKLTFLIQGFREMIRNLTQSLAFETFIFFVVCLNTVMLVAQTFAEVEIRGEWYFMALDSIFFCI    421 - 490
YVVEALLKIIALGLSYFFDFWNNLDFFIMAMAVLDFLLMQTHSFAIYHQSLFRILKVFKSLRALRAIRVL    491 - 560
RRLSFLTSVQEVTGTLGQSLPSIAAILILMFTCLFLFSAVLRALFRKSDPKRFQNIFTTIFTLFTLLTLD    561 - 630
DWSLIYMDSRAQGAWYIIPILVIYIIIQYFIFLNLVITVLVDSFQTALFKGLEKAKQERAARIQEKLLED    631 - 700
SLTELRAAEPKEVASEGTMLKRLIEKKFGTMTEKQQELLFHYLQLVASVEQEQQKFRSQAAVIDEIVDTT    701 - 770
FEAGEEDFRN                                                                771 - 780
//

Text Mined References (30)

PMID Year Title
26989199 2016 Unconventional endocannabinoid signaling governs sperm activation via the sex hormone progesterone.
26453676 2015 Specific loss of CatSper function is sufficient to compromise fertilizing capacity of human spermatozoa.
26354096 2015 Analysis of the correlation of CATSPER single nucleotide polymorphisms (SNPs) with idiopathic asthenospermia.
25416956 2014 A proteome-scale map of the human interactome network.
25101494 2014 The transcription factors Sox5 and Sox9 regulate Catsper1 gene expression.
24927181 2014 Genome-wide association study identifies three novel susceptibility loci for severe Acne vulgaris.
23623968 2013 Progesterone utilizes the PI3K-AKT pathway in human spermatozoa to regulate motility and hyperactivation but not acrosome reaction.
23530196 2013 Disruption of the principal, progesterone-activated sperm Ca2+ channel in a CatSper2-deficient infertile patient.
23344959 2013 Ca2+ signals generated by CatSper and Ca2+ stores regulate different behaviors in human sperm.
23313885 2013 Molecular cloning and analysis of the Catsper1 gene promoter.
22354039 2012 The CatSper channel: a polymodal chemosensor in human sperm.
21516116 2011 Next-generation sequencing to generate interactome datasets.
21412339 2011 Progesterone activates the principal Ca2+ channel of human sperm.
21412338 2011 The CatSper channel mediates progesterone-induced Ca2+ influx in human sperm.
21404705 2011 [CatSper1 protein and idiopathic asthenozoospermia].
20648059 2010 Genetic male infertility and mutation of CATSPER ion channels.
19344877 2009 Human male infertility caused by mutations in the CATSPER1 channel protein.
18976756 2009 Inhibition of human sperm function and mouse fertilization in vitro by an antibody against cation channel of sperm 1: the contraceptive potential of its transmembrane domains and pore region.
17347248 2007 Expression of CatSper family transcripts in the mouse testis during post-natal development and human ejaculated spermatozoa: relationship to sperm motility.
16740636 2006 Association of Catsper1 or -2 with Ca(v)3.3 leads to suppression of T-type calcium channel activity.
16625279 2006 The expression and significance of CATSPER1 in human testis and ejaculated spermatozoa.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
16382101 2005 International Union of Pharmacology. L. Nomenclature and structure-function relationships of CatSper and two-pore channels.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14688170 2004 CatSper gene expression in postnatal development of mouse testis and in subfertile men with deficient sperm motility.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11675491 2001 A voltage-gated ion channel expressed specifically in spermatozoa.
11595941 2001 A sperm ion channel required for sperm motility and male fertility.
11595929 2001 Ion channels. Swimming with sperm.