Property Summary

NCBI Gene PubMed Count 302
PubMed Score 3190.72
PubTator Score 7740.29

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Acatalasia 2 0.0 5.0
Disease Target Count
Acatalasemia 1

Expression

  Differential Expression (26)

Disease log2 FC p
psoriasis -1.700 6.0e-05
Waldenstrons macroglobulinemia 3.072 2.3e-03
malignant mesothelioma -2.900 4.6e-08
osteosarcoma -1.886 2.1e-03
posterior fossa group B ependymoma 1.600 7.3e-11
astrocytoma 1.500 3.1e-02
glioblastoma 1.300 1.2e-02
acute quadriplegic myopathy 1.329 2.8e-04
Atopic dermatitis -1.200 5.2e-04
adrenocortical carcinoma -1.450 9.5e-06
tuberculosis 1.400 2.0e-05
pancreatic ductal adenocarcinoma liver m... -2.435 1.4e-03
non-small cell lung cancer -1.727 3.2e-27
lung cancer -2.500 2.1e-06
ulcerative colitis -1.300 2.9e-05
breast carcinoma -1.400 7.8e-04
fibroadenoma -1.700 9.6e-03
interstitial cystitis -1.400 2.5e-04
lung adenocarcinoma -2.200 5.8e-17
aldosterone-producing adenoma -1.025 3.5e-02
lung carcinoma -1.100 1.4e-14
ductal carcinoma in situ -2.000 1.8e-04
invasive ductal carcinoma -2.000 1.5e-03
ovarian cancer -2.100 3.3e-06
pituitary cancer -1.500 1.1e-03
Down syndrome 1.300 1.3e-03

 OMIM Phenotype (1)

Protein-protein Interaction (3)

Gene RIF (284)

PMID Text
26990426 In patients with chronic hepatitis C, the GPX1 Pro198Leu polymorphism, alone or combined with the CAT C-262T, was associated with high risk of fibrosis severity and hepatocellular carcinoma (HCC). In addition, GPX1 polymorphism was also associated with advanced stages of HCC.
26342455 Increasing the endogenous NO level causes catalase inactivation and reactivation of intercellular apoptosis signaling specifically in tumor cells.
26198800 no significant correlations found between fertility and semen catalase activity
26125826 SOD, CAT, and GSH-PX content in the aqueous fluid and lenses decreased significantly with increasing lenticular nucleus hardness grading
26117330 Deciphering the molecular mechanisms that regulate catalase expression could, therefore, be of crucial importance for the future development of pro-oxidant cancer chemotherapy.
26074427 Data suggest that embryonic catalase is a determinant of risk for EtOH embryopathies.
26045794 This study identified CAT is a Noise-induced hearing loss susceptibility gene when noise exposure levels are taken into account.
25894370 No significant associations were observed between three other polymorphisms (MnSOD Ala16Val, CAT-262C/T, GPx Pro198Leu) and HCC susceptibility in both HBV carriers and non-HBV carriers
25866291 the ratios SOD2/catalase and SOD2/Gpx1 could be considered as potential markers during progression from tumor growth to metastasis
25837767 the CAT rs769217 T allele is associated with increased risk of chronic hepatitis B, hepatitis B virus-related liver cirrhosis and hepatocellular carcinoma in Guangxi population
25837760 the catalase C-262T polymorphism may be a risk factor for cancer
25818327 Study shows that the SOD2 16C/T and CAT -21A/T alleles may serve as useful genetic susceptibility markers for migraine
25786472 Functional roles of catalase, PRDX2 and GPX1 during oxidative stress in human erythrocytes.
25772105 The four novel mutations were probably responsible for low blood catalase activity in 7/51 patients. In the remainder of the cases, other polymorphisms and epigenetic/regulatory factors may be involved.
25739358 cimetidine could bind to human erythrocyte catalase, and its interaction caused functional and conformational changes in the enzyme.
25697005 Different polymorphic C262T catalase gene variants modulate apoptosis of primary mononuclear cells in conditions of oxidative stress.
25667417 Data indicate that catalase was detected in primary hepatic stellate cells, and addition of the competitive catalase inhibitor hydroxylamine resulted in a dose-dependent impairment of myeloid-derived suppressor cells (MDSC) induction.
25576221 This meta-analysis suggests a positive correlation between Catalase C-262T polymorphism and the development of prostate cancer.[meta-analysis]
25514903 Findings suggest that the CAT c.-262C>T genetic polymorphism influences the susceptibility to alcohol dependence and severity of alcohol dependence in males.
25484013 might associate with noise-induced hearing loss, independently or interactively with SOD2 and GJB2
25395496 polymorphisms of NQO1, CAT, and GSTM1 are involved in modulation effect of sodium arsenite on chromosomal aberration indices
25307973 The CYBA C-242T and CAT C-262T genetic polymorphisms and their epistatic interactions can be associated with ICC through mechanisms related with the role of ROS in cell proliferation and apoptosis.
25248722 There was no association between C-262 T polymorphism of the CAT and risk of breast cancer.
25086217 Data suggest that the conserved Val74 of true catalases helps optimize catalysis.
25085901 our results establish a pathway consisting of miR-551b/catalase/ROS that results in MUC1 overexpression, and intervention against this pathway could be exploited to overcome acquired chemoresistance.
25033027 study indicates that CAT -262T/T genotype confers less susceptibility to spontaneous abortion, while GPX1 Pro198Leu polymorphism may not be correlated with the disease
24915010 This study evaluates the oxidative stress status, the role of catalase (CAT) and catechol-O-Methyltransferase (COMT) gene polymorphisms in the etiology of generalized vitiligo in Egyptians.
24825136 After pooling all studies, the results indicated that the 389 C/T polymorphisms in CAT were not associated with the risk of vitiligo in Asians and Turks.
24824229 The catalase -262CT+TT genotype was significantly associated with adult-onset asthma in smokers.
24817970 Six tag single nucleotide polymorphisms of the catalase gene may not be associated with post-traumatic stress disorder.
24630930 Catalase expression is increased in MCF-7 breast cancer cells but not in resistance to oxidatively stressed cells.
24602691 Study provides evidence that microglial catalase activity is elevated in multiple sclerosis (MS) grey matter and may be an important endogenous anti-oxidant defence mechanism in MS
24583396 catalase may regulate cathepsin activity by controlling the production of ROS (H2O2), leading to variation in migration and invasion ability of lung cancer cells.
24517502 Variability within the CAT gene may be an important modifier of the clinical course of Wilson Disease.
24480751 Exposure to HIV-1 clade B Tat protein has a greater inhibition of GSS, GPx1, SOD1, and CAT expression compared with exposure to clade C Tat protein in monocyte-derived immature dendritic cells
24456074 The catalase C-262T polymorphism indicates that CAT-262T/T genotype confers less susceptibility to male infertility.
24305782 Serum catalase activity in patients with chronic tonsillitis was significantly higher than in healthy controls.
24215654 This mutation is possibly associated with various clinical indices important for POAG and thus may be used as a parameter for assessing POAG severity, at least in this population.
24057136 CAT variants were associated with the prevalence and incidence of diabetic nephropathy and ESRD in type 1 diabetic patients. Our results confirm the protective role of catalase against oxidative stress in the kidney.
23961996 The catalase promoter variant rs1001179 SNP is not a risk factor for primary angle closure glaucoma in Saudi patients.
23911407 Data indicate that transgenic mice over-expressing human SOD1 or catalase were protected from loss of plasma membrane integrity (LPMI) at early but not late periods of reperfusion.
23868633 We found no association between CAT gene -89A>T and 389C>T polymorphism and vitiligo susceptibility in Turkish vitiligo patients
23828460 siRNAmediated knockdown of their expression sensitized the cells to nickel-induced apoptosis, suggesting that Bcl-2, Bcl-xl and catalase protein expression plays a critical role in apoptosis resistance
23827365 The TT genotype of catalase was more frequent among the asthmatic patients than in healthy Slovak children. The -262 C/T promoter polymorphism may contribute to asthma and oxidative damage.
23781296 Serum samples were obtained to detect the antioxidative enzymes of superoxide dismutase (SOD), catalase (CAT), and glutathione peroxidase in Sixty patients with age-related cataract.
23773345 TT genotype in the CAT C-262T polymorphism may be associated with increased prostate cancer risk
23771908 Data indicate a vital role for antioxidant enzymes, including catalase and superoxide dismutase, in facilitating the survival of breast cancer cells after extracellular matrix (ECM)-detachment.
23746122 Serum catalase activity was decreased in patients with adult nephrotic syndrome.
23701472 failed to demonstrate an association between either the -262C/T of the catalase gene promoter (rs1001179) or the C242T polymorphism of the P22phox gene (rs4673) or the 594C/T polymorphism of the glutathione peroxidase gene (rs1050450) and hypertension
23641975 This study shows that catalase activity and its SNPs seem to play a role in various aspects of the metabolic alterations which take place in obesity.
23461612 These findings support an association between oxidized CAT and systemic lupus erythematosus.
23425094 CAT C-262T polymorphism may be associated with UC, and that the -262C/T genotype may be a risk factor for the disease
23390647 This study is the first to show that the polymorphism -21A>T CAT is associated with increased risk of cerebral stroke in hypertensive men, however, the relationship between the polymorphism and risk of cerebrovascular disease depends on whether the patients have environmental risk factors or not.
23383735 Catalase over-expression might be sufficient to enhance cognition and reduce measures of anxiety
23340375 The present study highlights the roles of CAT haplotypes in arterial aging and underlines the beneficial impact of the CAT1 haplotype on mean internal diameter of the CCA and atheromatous plaque number as well as on potential associated diseases.
23325794 SNPs in CYP1B1 and catalase are linked to ex vivo benzo(a)pyrene related DNA adduct formation. Expression of catalase strongly correlated with expression of CYP1B1.
23212700 A CATc.66+78C>T polymorphism is associated with noradrenaline plasma concentration in schizophrenic patients.
23098659 Genotype-dependent response of catalase activity to oxidative stress might be related to the predisposition of catalase mutant allele carriers to disorders mediated by oxidative stress
23066387 Five SNPs from two genes (CAT (rs11032703, rs2300181, rs511895) and NQO1 (rs1800566, rs1437135)) were associated with asthma in an industrial rural area of Quebec.
22998821 low CAT activity was associated with an increased risk of colorectal cancer(CRC); however, no evidence was found to support an association between CAT-21A > T polymorphism and CRC risk
22970972 Data show that T allele of catalase (CAT) and C allele of superoxide dismutase (SOD1) were significant risk factors for type 2 diabetes mellitus (T2DM).
22959522 SNP was shown to have limited association with the risk of PCa (rs554518; P = .09443) in all SNPs of CAT.
22958044 Genetic polymorphisms of antioxidant enzymes in preterm infants.
22907559 Data suggest that serum catalase activity is higher in patients with either pemphigus vulgaris or pemphigus foliaceus than in control subjects, with patients with pemphigus vulgaris exhibiting the highest catalase levels.
22880027 The post-transcriptional control of gene expression via miRNA modulation regulates human catalase.
22736749 the study supports the notion of in vivo oxidative stress in systemic lupus erythematosus as indicated by the decrease in CAT activity; allelic variations in the CAT gene -262 are more likely to affect the expression or function of the enzyme
22645453 coenzyme Q10, superoxide dismutase, and oxidative stress have roles in coronary artery disease, but the effect of malondialdehyde, catalase, and glutathione peroxidase is not significant
22556393 Exposure to HIV-1 clade B Tat protein has a greater inhibition of GSS, GPx1, SOD1, and CAT expression compared with exposure to clade C Tat protein in monocyte-derived immature dendritic cells
22465269 Results indicate that increased myeloperoxidase activity and decreased catalase activity is associated with increased oxidative stress, which may have a role in atherosclerotic processes in brucellosis patients.
22286031 analysis of polymorphisms of catalase exon 9: rs769217 in Hungarian microcytic anemia and beta-thalassemia patients
22242279 increased activity correlates with disease progression in pneumoconiosis patients
22167619 The common MnSOD, GPX1, and CAT TT+CC+CC genotype may contribute to hypertriglyceridemia in Chinese patients with type 2 diabetes or diabetic cardiovascular disease.
22108257 Mitochondrial (mt)DNA haplogroups show an influence on serum levels of catalase among osteoarthritis patients. Carriers of mtDNA haplogroup J show higher serum levels than non-J carriers.
22089180 There was no evidence for CATint10(T9C) gene polymorphism association with bone mineral density.
22058000 no association between CAT (Asp-389) gene polymorphism and vitiligo susceptibility in Turkish vitiligo patients.
21985966 Oct-1 is downregulated by reactive oxygen species via CpG island methylation in its promoter
21985133 blood catalase activity and the relationship of blood catalase and beta-thalassemia gene mutations
21976670 interaction of PEX5 with catalase and PEX14
21968610 Histone H4 deacetylation down-regulates catalase gene expression in doxorubicin-resistant AML subline.
21964540 The catalase-like oxygen production by human methemoglobin in the presence of H(2)O(2) was kinetically characterized with a Clark-type electrode.
21947853 The -262 C>T polymorphism has a reverse effect on blood catalase in vitiligo patients and in controls.
21921984 In CAT-21A/T and GPX1-198C/T polymorphisms, there were no significant differences in the variant homozygous frequencies in patients compared to controls.
21829032 The levels of SOD and CAT activity were significantly related to adult asthma.
21827848 genetic polymorophism affects the efficiency of renutrition in malnourished elderly patients
21799178 Hydrogen peroxide derived from myeloid cells overexpressing catalase promotes neovascularization in response to ischemia and is a necessary factor for the development of ischemia-induced inflammation.
21689642 This study assessed the influence of catalase overexpression on the sensitivity of breast cancer cells towards various anticancer treatments.
21417634 Up-regulation of CAT and GR activity resulted in an increase in total antioxidant activity in A549 after exposure to B(a)P.
21295602 The embryonic catalase transgene, although expressed at about 5% of maternal activity, may protect the embryo by detoxifying reactive oxygen species. Transgenic embryonic catalase activity may be a determinant of teratological risk.
21191398 catalase expression/activity is an important effector in the responses of melanocytes to aging
21180245 Data does not suggest an effect of 21A/T (rs7943316) polymorphism of catalase gene in the susceptibility for diabetic nephropathy in Romanian patients with type 1 diabetes
21179281 No association was found between clinical outcome of acute paraquat intoxication and the genetic polymorphism of GPX1 (C593T) or the genetic polymorphisms or enzyme activity of superoxide dismutase (V16A) or catalase (C262T).
21131394 TGF-beta induced the expression of Nox4 while at the same time inhibiting the expression of MnSOD and catalase in airway smooth muscle cells.
21109199 Targeted expression of human catalase to mitochondria prevents age-associated reductions in mitochondrial function and insulin resistance in a mouse model.
21083503 Whole-body cryotherapy of multiple sclerosis patients resulted in the significant increase of total antioxidative status level in plasma but had no effects on activities of CAT.
21069346 Prenatal treatment with drugs which can upregulate SOD2 and CAT transcripts may have a therapeutic potential in preventing omphalocele phenotype.
21054877 Observational study of gene-disease association. (HuGE Navigator)
21054578 we concluded that CAT TC exon 9 polymorphism may play an important role in vitiligo disease development and may serve as a genetic marker of vitiligo risk.
21054578 Meta-analysis of gene-disease association. (HuGE Navigator)
21053180 Observational study of gene-disease association. (HuGE Navigator)
20923778 catalase-amyloid interactions have a role in Abeta-induced oxidative stress
20878976 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20851292 Observational study of gene-disease association. (HuGE Navigator)
20732340 Chronic arsenic exposure causes higher serum catalase activity that correlates with induction of genetic damage.
20727719 The association between the catalase C-262T polymorphism and melanoma risk was significantly modified by the history of severe sunburns and total carotenoid intake.
20727719 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20649881 Suggest that -262C/T polymorphism in the catalase gene is associated with delayed graft function in kidney allograft recipients.
20649881 Observational study of gene-disease association. (HuGE Navigator)
20643115 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20613769 CAT -89A>T variant genotypes were associated with a significant decrease in catalase enzyme activity and a genetic predisposition for vitiligo in Chinese people
20613769 Observational study of gene-disease association. (HuGE Navigator)
20494887 Observational study of gene-disease association. (HuGE Navigator)
20485444 Observational study of gene-disease association. (HuGE Navigator)
20444272 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20416077 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20301895 Observational study of gene-disease association. (HuGE Navigator)
20194081 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
20110814 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20109103 the influences of the haptoglobin, MnSOD, CAT, GPX1, ACE, glutathione S-transferases M1 (GSTM1) and T1 (GSTT1) genes' polymorphisms on the oxidative stress and damage suffered by human runners was studied
20109103 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20105444 enzyme activity is reduced in systemic lupus erythematosus patients
20097730 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20082261 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20078877 Observational study of gene-disease association. (HuGE Navigator)
20049130 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20020532 Observational study of gene-disease association. (HuGE Navigator)
19949914 The expression of catalase was decreased following exposure of tumor cells to cigarette smoke condensate.
19929244 The CAT TT genotypes were more frequent in hepatocellular carcinoma than in control.
19929244 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19902075 The increase in activities of catalase was maximum in patients with the most severe burns.
19897742 Shear stress decreases PKCdelta activity, altering the phosphorylation pattern catalase, leading to decreased catalase activity and increased hydrogen peroxide signaling.
19897513 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
19896490 Observational study of gene-disease association. (HuGE Navigator)
19874574 Observational study of gene-disease association. (HuGE Navigator)
19863340 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19855359 The obtained results indicate no correlation between -262C>T polymorphism of the CAT gene (both with respect to genotype distribution and allele frequency) and the risk of depression.
19855359 Observational study of gene-disease association. (HuGE Navigator)
19787204 The present study is the first to evaluate the expression and activity of MnSOD, Cu/ZnSOD and catalase in human gastric samples.
19731237 Observational study of gene-disease association. (HuGE Navigator)
19705749 Observational study of gene-disease association. (HuGE Navigator)
19692168 Observational study of gene-disease association. (HuGE Navigator)
19688952 Serum levels of catalase were lower in patients with complete hydatidiform mole when compared with the Healthy pregnant and non-pregnant controls
19625176 Observational study of gene-disease association. (HuGE Navigator)
19622717 We observed no effect modification either by smoking on the association between genetic polymorphisms in CAT, MnSOD, MPO, or eNOS and colorectal cancer
19622717 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19584075 Observational study of gene-disease association. (HuGE Navigator)
19538885 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19505917 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19497990 oxidative damage induced by decreased catalase is involved in Granular corneal dystrophy type II pathogenesis
19424819 The aim of this study was to assess the distribution of CAT C-262T and GPX1 Pro198Leu genotypic variants in a Turkish population.
19424819 Observational study of genotype prevalence. (HuGE Navigator)
19409565 Overexpression of catalase/SOD1 in ApoE-deficient mice suppresses benzo(a)pyrene-accelerated atherosclerosis.
19399816 Enhanced oxidative stress and a decrease in the number of anti-oxidant enzymes may be associated with pre-eclampsia.
19373626 Cigarette smoking, fruit and vegetable intakes have potentially inverse modifying influences on the asthma risk in individuals with -21AA CAT genotype. Gene-environment interactions support plausibility of CAT gene for the development of bronchial asthma.
19373626 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19341793 The catalase is an H2O2 scavenger, suggest that endogenously produced H2O2 mediates MAEC proliferation by fostering the transition from G0/G1 to S phase.
19336475 Observational study of gene-disease association. (HuGE Navigator)
19274593 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19255063 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19254215 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19242068 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19172437 Erythrocyte catalase activity was significantly lower in eclamptic pregnant women when compared with healthy pregnant women and non-pregnant women.
19170196 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19124506 Observational study of gene-disease association. (HuGE Navigator)
19092850 catalase inhibits monocytic differentiation by TPA; the decrease in catalase level and the accumulation of H(2)O(2) are significant events for monocyte/macrophage differentiation by TPA
19064360 the CAT -262 TT genotype may be slightly associated with an increased risk of asbestosis
19064360 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19050255 Enhanced expression of the antioxidant enzyme catalase in human T cells can protect them against reactive oxygen species.
18977241 Observational study of gene-disease association. (HuGE Navigator)
18949620 In AML and APL cell lines, but not primary patient samples, basal catalase levels matched sensitivity to As2O3.
18936436 Observational study of genotype prevalence. (HuGE Navigator)
18930811 Increased catalase expression is associated with multiple sclerosis lesions.
18682580 SOD2, SOD3, and CAT genes may influence brain tumor risk.
18634817 By chronically reducing catalase activity to approximately 38% of normal, cells respond in a dramatic manner, displaying a cascade of accelerated aging reactions.
18606005 An oxidatively modified catalase could be one of the reasons for lower enzymatic activity among SLE subjects, which in turn could favor the accumulation of deleterious hydrogen peroxide
18606005 Observational study of gene-disease association. (HuGE Navigator)
18485895 Sirt1 overexpression rescued H(2)O(2)-induced apoptosis through the upregulation of catalase.
18483329 CAT genotype modifies the effect of HRT use on breast cancer risk and HRT may affect risk by affecting oxidative stress.
18483329 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18469277 Among the SNPs studied, the G-844A, A-89T and C-20T catalase mutant alleles were associated with a lower efficiency of renutrition in malnourished elderly subjects.
18469277 Observational study of gene-disease association. (HuGE Navigator)
18423055 Observational study of gene-disease association. (HuGE Navigator)
18415766 The primary factor causing the oxidative stress observed in rheumatoid arthritis and systemic lupus erythematosus is excessive free radical production rather than impaired catalase or superoxide dismutase activity due to autoantibody inhibition.
18368408 the CAT -330CC genotype may contribute to some clinical manifestations in patients with systemic lupus erythematosus
18368408 Observational study of gene-disease association. (HuGE Navigator)
18353692 Observational study of gene-disease association. (HuGE Navigator)
18248894 This data do not support a role of two gene polymorphisms of the CAT rs1001179 as a possible susceptibility factors for sporadic AD.
18248894 Observational study of gene-disease association. (HuGE Navigator)
18171680 catalase, CK2, and ARC constitute an anti-hypertrophic pathway in the heart.
18048809 Functional promoter variants in CAT and HMOX-1 showed ethnicity-specific associations with new-onset asthma.
17937824 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17879952 TNF-alpha mediated downregulation of catalase expression and accordingly sufficient H(2)O(2) is required for appropriate function of the NF-kappaB dependent survival pathway.
17850515 study shows the well-documented CAT exon 9 T/C & GPX 1 codon 200 polymorphisms may not be associated with Gujarat vitiligo patients; results suggest presence of novel SNPs in Gujarat vitiligo population
17696155 We have developed a novel AAV vector to enhance catalase expression. Lack of apparent toxicity in normal muscle strongly supports further exploration of this vector to reduce oxidative stress-induced muscle damage.
17693525 Observational study of gene-disease association. (HuGE Navigator)
17646900 Significant positive correlations were found between CAT(catalase) and MDA (malondialdehyde) and between CAT and C-reactive protein in children in the active stage of Henoch-Schonlein purpura; CAT levels were lower in patients
17634480 Observational study of gene-disease association. (HuGE Navigator)
17601350 Observational study of gene-disease association. (HuGE Navigator)
17577741 Observational study of gene-disease association. (HuGE Navigator)
17577741 C111T polymorphism may implicate a very weak effect on blood catalase activity in different types of diabetes mellitus.
17567781 Observational study of gene-disease association. (HuGE Navigator)
17567781 Catalase is a Noise-induced hearing loss susceptibility gene, but that the effect of CAT polymorphisms can only be detected when noise exposure levels are taken into account.
17567676 Observational study of gene-disease association. (HuGE Navigator)
17567676 analysis of superoxide dismutase and catalase polymorphisms in smokers with COPD
17566139 The increase in oxidative stress induced by various fatty acids in Jurkat and Raji cells partially occurs due to a reduction in catalase activity.
17549373 Observational study of gene-disease association. (HuGE Navigator)
17549373 Polymorphisms in catalase is associated with precancerous changes in the gastric mucosa
17548672 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17264407 Observational study of gene-disease association. (HuGE Navigator)
17213227 The muscle of patients undergoing haemodialysis undergoes some adaptive responses in total glutathione content, heat shock protein content and catalase activity that are potentially related to chronic oxidative stress.
17209132 Observational study of gene-disease association. (HuGE Navigator)
17209132 findings show that the +22348CT polymorphism and HT4 haplotype of the CAT gene were associated with bone mineral density and bone turnover markers in postmenopausal Korean women
17171548 Systemic activity of the enzymatic antioxidants (CuZn/SOD, MnSOD, GSH-Px, and CAT) as well as level of lipid peroxidation determined by MDA may not be increased in the course of immune-inflammatory processes associated with chronic idiopathic urticaria.
17145829 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17005595 Mean relative levels of catalase & its mRNA were significantly decreased in women > or =38 years, which may account for granulosa-cell changes associated with reproductive aging.
16956821 Observational study of gene-disease association. (HuGE Navigator)
16868544 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
16775184 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
16773213 A statistically significant higher malondialdehyde concentration in erythrocytes and blood plasma and a higher activity of SOD or CAT in erythrocytes was shown in patients with a brain tumour.
16729966 Observational study of gene-disease association. (HuGE Navigator)
16729966 The C/T genotype was significantly over-represented in the vitiligo patient group compared with the control cohort.
16644728 catalase overexpression has a protective role against Ultraviolet B irradiation by preventing DNA damage mediated by the late reactive oxygen species increase.
16630078 Observational study of gene-disease association. (HuGE Navigator)
16600249 overexpression of Cu, Zn-SOD and/or catalase in smooth muscle cells attenuates the cell proliferation caused by oxLDL stimulation
16586065 Catalase in human enzyme transfected mice rescues insulin-resistance-induced cardiac dysfunction related to ROS production and protein oxidation but probably does not improve insulin sensitivity.
16523188 Observational study of gene-disease association. (HuGE Navigator)
16523188 protective role of the -262T allele of the CAT gene against the rapid development of diabetic nepheropathy.
16504657 Catalase activity may correlate with the concentration of hypoxanthine in the graft renal vein and other mediators of oxidative stress.
16467073 Observational study of gene-disease association. (HuGE Navigator)
16453382 Observational study of gene-disease association. (HuGE Navigator)
16453382 No evidence for a major effect of C1167T or C(-262)T sinsgle nucleotide polymorphism on type 1 diabetes mellitus susceptibility in two large sample collections.
16424062 Observational study of gene-disease association. (HuGE Navigator)
16387755 Cells were exposed to 250 microM hydrogen peroxide and and cell survival, mitochondria transfection with catalase function, were examined.
16385446 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
16298864 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
16204228 catalase has a critical role in CSF-independent survival of human macrophages via regulation of the expression of BCL-2 and BCL-XL
16192345 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
16192345 The high-activity catalase CC genotype was associated with an overall 17% reduction in risk of breast cancer compared with having at least one variant T allele.
16098030 the accumulation of reactive oxygen species due to catalase attenuation may be a critical aspect of the MAP kinase signaling changes that may lead to skin aging and photoaging in human skin in vivo
16076760 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16047490 Observational study of gene-disease association. (HuGE Navigator)
16026777 catalase activities in healthy persons
15988600 genetic polymorphisms of CAT do not play a significant role in the susceptibility to RA in Koreans
15934434 Genetic polymorphisms of CAT and PPARy2 do not play a significant role in the development of SLE in a Korean population.
15870505 Adenovirus-mediated gene transfer of superoxide dismutase and catalase reduced oxidative stress, restenosis, collagen accumulation, and inflammation and improved endothelial function after angioplasty.
15800961 The novel G-->A mutation in exon 9 changes the essential amino acid Arg 354 to Cys 354 and may be responsible for the decreased catalase activity causing diabetes mellitus.
15774926 Observational study of gene-disease association. (HuGE Navigator)
15735318 Observational study of gene-disease association. (HuGE Navigator)
15735318 Genetic variations in the promoter region of catalase gene influence the susceptibility to essential hypertension.
15733034 catalase activates the growth of HL60 cells through dismutation of H(2)O(2), leading to activation of the ERK1/2 pathway; H(2)O(2) is an important regulator of growth in HL60 cells
15705913 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
15556604 SHP2 binds CAT and acquires a hydrogen peroxide-resistant phosphatase activity via integrin-signaling.
15528999 overexpression of human catalase in DF-1 cells endowed cells resistant to the oxidative stress by antimycin A treatment
15472150 Observational study of gene-disease association. (HuGE Navigator)
15203188 catalase and hepatocyte growth factor have roles in ceramide-induced apoptosis
15182856 catalase (447)Tyr-Val-Asn-Val binds Grb2 upon phosphorylation in tumor cells when stimulated with serum or ligands for integrin receptors
15133753 findings support evidence of a new putative type 1 diabetes susceptibility locus for the catalase gene on chromosome 11p13
15131792 Observational study of gene-disease association. (HuGE Navigator)
15125229 Observational study of gene-disease association. (HuGE Navigator)
14975589 Exposure to HIV-1 clade B Tat protein has a greater inhibition of GSS, GPx1, SOD1, and CAT expression compared with exposure to clade C Tat protein in monocyte-derived immature dendritic cells
14962975 High catalase activity in human alveolar macrophages limits the effectiveness of H2O2 to act as a mediator of inflammatory gene expression.
14710363 effect of IGFBP-2 overexpression on the activity of catalas in two malignant cell lines
14580687 Observational study of gene-disease association. (HuGE Navigator)
12950161 findings indicate that, in addition to stimulating catalase activity, c-Abl and Arg promote catalase degradation in the oxidative stress response
12838770 Catalase activity in pulmonary diseases was suppressed by 38-45%.
12824748 Observational study of gene-disease association. (HuGE Navigator)
12730222 data indicate that catalase plays a direct role in generating oxidants in response to UVB light
12606529 results suggest that high glucose flux through aldose reductase inhibits the expression of catalase, CuZn superoxide-dismutase and glutathione peroxidase
12603857 conclude that sun exposure results in a disturbed catalase to superoxide dismutase ratio in the stratum corneum
12516882 activities of catalase (CAT), glutathione reductase (GR), glutathione peroxidase (GPx) and superoxide dismutase (SOD) were decreased during intense physical exercise
12487379 cell signaling molecules regulate catalase to control cell mitogenesis
12469627 Observational study of gene-disease association. (HuGE Navigator)
12468545 the level of catalase may play a critical role in cell-induced resistance to the effects of anti-cancer drugs which up-regulate p53
12447480 Malignant lung tumors (squamous cell carcinoma and adenocarcinoma) had significantly decreased levels of this enzyme.
12372460 Abnormal expression of catalase in the eutopic and ectopic endometrium strongly suggests pathologic involvement of free radicals in endometriosis and adenomyosis
12231449 Observational study of gene-disease association. (HuGE Navigator)
12165738 The results confirm the involvement of antioxidant enzymes, including catalase, in the pathogenesis of psoriasis.
12110367 catalase in livers enhances drug oxidation activities catalyzed by P450 in human liver microsomes.
12032677 results suggest that IGF-1/PI-3 kinase inhibited C2-ceramide-induced apoptosis due to relieving oxidative damage, which resulted from the inhibition of catalase by activated caspase-3
11907164 expression of catalase either in the cytosol or mitochondrial compartments was able to abolish the loss of mitochondrial membrane potential or damage to mitochondria observed in HepG2 cells overexpressing CYP2E1
11837458 Observational study of gene-disease association. (HuGE Navigator)
11479740 Observational study of gene-disease association. (HuGE Navigator)
11182520 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MADSRDPASDQMQHWKEQRAAQKADVLTTGAGNPVGDKLNVITVGPRGPLLVQDVVFTDEMAHFDRERIP      1 - 70
ERVVHAKGAGAFGYFEVTHDITKYSKAKVFEHIGKKTPIAVRFSTVAGESGSADTVRDPRGFAVKFYTED     71 - 140
GNWDLVGNNTPIFFIRDPILFPSFIHSQKRNPQTHLKDPDMVWDFWSLRPESLHQVSFLFSDRGIPDGHR    141 - 210
HMNGYGSHTFKLVNANGEAVYCKFHYKTDQGIKNLSVEDAARLSQEDPDYGIRDLFNAIATGKYPSWTFY    211 - 280
IQVMTFNQAETFPFNPFDLTKVWPHKDYPLIPVGKLVLNRNPVNYFAEVEQIAFDPSNMPPGIEASPDKM    281 - 350
LQGRLFAYPDTHRHRLGPNYLHIPVNCPYRARVANYQRDGPMCMQDNQGGAPNYYPNSFGAPEQQPSALE    351 - 420
HSIQYSGEVRRFNTANDDNVTQVRAFYVNVLNEEQRKRLCENIAGHLKDAQIFIQKKAVKNFTEVHPDYG    421 - 490
SHIQALLDKYNAEKPKNAIHTFVQSGSHLAAREKANL                                     491 - 527
//

Text Mined References (310)

PMID Year Title
26990426 2016 Association of Catalase and Glutathione Peroxidase 1 Polymorphisms with Chronic Hepatitis C Outcome.
26342455 2015 Increasing the endogenous NO level causes catalase inactivation and reactivation of intercellular apoptosis signaling specifically in tumor cells.
26198800 2015 Decreased activity of superoxide dismutase in the seminal plasma of infertile men correlates with increased sperm deoxyribonucleic acid fragmentation during the first hours after sperm donation.
26125826 2015 Antioxidant content and cytological examination of aqueous fluid from patients with age-related cataracts at different stages.
26117330 2015 Regulation of catalase expression in healthy and cancerous cells.
26074427 2015 Embryonic catalase protects against ethanol embryopathies in acatalasemic mice and transgenic human catalase-expressing mice in embryo culture.
26045794 2015 Identification of functional tag single nucleotide polmorphisms within the entire CAT gene and their clinical relevance in patients with noise-induced hearing loss.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25894370 2015 Genetic polymorphisms in antioxidant enzyme genes and susceptibility to hepatocellular carcinoma in Chinese population: a case-control study.
25866291 2015 Manganese superoxide dismutase (SOD2/MnSOD)/catalase and SOD2/GPx1 ratios as biomarkers for tumor progression and metastasis in prostate, colon, and lung cancer.
25837767 2015 Association between catalase gene polymorphisms and risk of chronic hepatitis B, hepatitis B virus-related liver cirrhosis and hepatocellular carcinoma in Guangxi population: a case-control study.
25837760 2015 The catalase C-262T gene polymorphism and cancer risk: a systematic review and meta-analysis.
25818327 2015 Superoxide Dismutase and Catalase Genotypes in Pediatric Migraine Patients.
25786472 2015 Peroxiredoxin 2, glutathione peroxidase, and catalase in the cytosol and membrane of erythrocytes under H2O2-induced oxidative stress.
25772105 2015 Further acatalasemia mutations in human patients from Hungary with diabetes and microcytic anemia.
25739358 2015 Functional and structural changes of human erythrocyte catalase induced by cimetidine: proposed model of binding.
25697005 2014 [Modulation of apoptosis in mononuclear cells with different variants of polymorphism C-262T in catalase gene].
25667417 2015 Contact-dependent depletion of hydrogen peroxide by catalase is a novel mechanism of myeloid-derived suppressor cell induction operating in human hepatic stellate cells.
25576221 2015 Catalase C-262T polymorphism and risk of prostate cancer: evidence from meta-analysis.
25514903 2015 Genetic variability in CYP2E1 and catalase gene among currently and formerly alcohol-dependent male subjects.
25484013 2014 Gene-gene interaction of GJB2, SOD2, and CAT on occupational noise-induced hearing loss in Chinese Han population.
25395496 Impact of sodium arsenite on chromosomal aberrations with respect to polymorphisms of detoxification and DNA repair genes.
25307973 2015 The role of CYBA (p22phox) and catalase genetic polymorphisms and their possible epistatic interaction in cervical cancer.
25248722 2015 Genetic Polymorphism of CAT C-262 T and Susceptibility to Breast Cancer, a Case-Control Study and Meta-Analysis of the Literatures.
25086217 2014 Inhibitory effects of a novel Val to Thr mutation on the distal heme of human catalase.
25085901 2014 A signaling pathway consisting of miR-551b, catalase and MUC1 contributes to acquired apoptosis resistance and chemoresistance.
25033027 2014 Polymorphisms of glutathione peroxidase 1 (GPX1 Pro198Leu) and catalase (CAT C-262T) in women with spontaneous abortion.
24915010 2014 Analysis of oxidative stress status, catalase and catechol-O-methyltransferase polymorphisms in Egyptian vitiligo patients.
24825136 2014 Association of the 389 C/T polymorphism of the catalase gene with susceptibility to vitiligo: a meta-analysis.
24824229 2014 Association of the CAT-262C>T polymorphism with asthma in smokers and the nonemphysematous phenotype of chronic obstructive pulmonary disease.
24817970 2014 Clinical relevance of tag single nucleotide polymorphisms within the CAT gene in patients with PTSD in the Chongqing Han population.
24630930 2014 Catalase expression in MCF-7 breast cancer cells is mainly controlled by PI3K/Akt/mTor signaling pathway.
24602691 2014 Increased microglial catalase activity in multiple sclerosis grey matter.
24583396 2014 The effect of catalase on migration and invasion of lung cancer cells by regulating the activities of cathepsin S, L, and K.
24517502 2015 Gene variants encoding proteins involved in antioxidant defense system and the clinical expression of Wilson disease.
24456074 2015 Human catalase gene polymorphism (CAT C-262T) and risk of male infertility.
24305782 2014 Assessment of adenosine deaminase (ADA) activity and oxidative stress in patients with chronic tonsillitis.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24215654 2013 Analysis of catalase SNP rs1001179 in Saudi patients with primary open angle glaucoma.
24057136 2013 Catalase activity, allelic variations in the catalase gene and risk of kidney complications in patients with type 1 diabetes.
23961996 2013 A catalase promoter variant rs1001179 is associated with visual acuity but not with primary angle closure glaucoma in Saudi patients.
23911407 2013 Loss of plasma membrane integrity, complement response and formation of reactive oxygen species during early myocardial ischemia/reperfusion.
23868633 No association between catalase (CAT) gene polymorphisms and susceptibility to vitiligo in a Turkish population.
23828460 2013 Anti-apoptotic proteins and catalase-dependent apoptosis resistance in nickel chloride-transformed human lung epithelial cells.
23827365 2013 Frequency of polymorphism -262 c/t in catalase gene and oxidative damage in Slovak children with bronchial asthma.
23781296 2013 Serum antioxidative enzymes levels and oxidative stress products in age-related cataract patients.
23773345 2013 Manganese superoxide dismutase Ile58Thr, catalase C-262T and myeloperoxidase G-463A gene polymorphisms in patients with prostate cancer: relation to advanced and metastatic disease.
23771908 2013 Antioxidant enzymes mediate survival of breast cancer cells deprived of extracellular matrix.
23746122 2013 Serum malondialdehyde levels, myeloperoxidase and catalase activities in patients with nephrotic syndrome.
23701472 2014 Association of the -262C/T polymorphism in the catalase gene promoter and the C242T polymorphism of the NADPH oxidase P22phox gene with essential arterial hypertension in patients with diabetes mellitus type 2.
23641975 2013 Are catalase -844A/G polymorphism and activity associated with childhood obesity?
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23461612 2013 Immunological studies of reactive oxygen species damaged catalase in patients with systemic lupus erythematosus: correlation with disease activity index.
23425094 2013 Catalase gene C-262T polymorphism: importance in ulcerative colitis.
23390647 2012 [Catalase gene polymorphism is associated with increased risk of cerebral stroke in hypertensive patients].
23383735 2013 Enhanced hippocampus-dependent memory and reduced anxiety in mice over-expressing human catalase in mitochondria.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23340375 2013 Relationship between catalase haplotype and arterial aging.
23325794 2013 Genetic polymorphisms in catalase and CYP1B1 determine DNA adduct formation by benzo(a)pyrene ex vivo.
23212700 2013 Association of SOD2, GPX1, CAT, and TNF genetic polymorphisms with oxidative stress, neurochemistry, psychopathology, and extrapyramidal symptoms in schizophrenia.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23098659 2012 Interaction between single nucleotide polymorphism in catalase gene and catalase activity under the conditions of oxidative stress.
23066387 2012 Association study of genes associated to asthma in a specific environment, in an asthma familial collection located in a rural area influenced by different industries.
22998821 2012 Association of catalase genotype with oxidative stress in the predication of colorectal cancer: modification by epidemiological factors.
22970972 2012 Association of polymorphic markers of the catalase and superoxide dismutase genes with type 2 diabetes mellitus.
22959522 2012 The association between polymorphisms in prooxidant or antioxidant enzymes (myeloperoxidase, SOD2, and CAT) and genes and prostate cancer risk in the Chinese population of Han nationality.
22958044 2012 Genetic polymorphisms of antioxidant enzymes in preterm infants.
22907559 2012 Catalase and lipid peroxidation values in serum of Tunisian patients with pemphigus vulgaris and foliaceus.
22880027 2012 MicroRNA-30b-mediated regulation of catalase expression in human ARPE-19 cells.
22736749 2012 Association of catalase gene polymorphisms with catalase activity and susceptibility to systemic lupus erythematosus in the Suez Canal area, Egypt.
22645453 2012 The relationship between coenzyme Q10, oxidative stress, and antioxidant enzymes activities and coronary artery disease.
22465269 2012 Serum myeloperoxidase activity and oxidative stress in patients with acute brucellosis.
22286031 2012 A simple method for examination of polymorphisms of catalase exon 9: rs769217 in Hungarian microcytic anemia and beta-thalassemia patients.
22242279 2011 [Functional state of RBC and neutrophils in pneumoconiosis patients variable in tolerance to dust factor in after contact period].
22167619 2012 Polymorphic variations in manganese superoxide dismutase (MnSOD), glutathione peroxidase-1 (GPX1), and catalase (CAT) contribute to elevated plasma triglyceride levels in Chinese patients with type 2 diabetes or diabetic cardiovascular disease.
22108257 2011 Mitochondrial DNA (mtDNA) haplogroups and serum levels of anti-oxidant enzymes in patients with osteoarthritis.
22089180 2012 Antioxidant enzymes GSR, SOD1, SOD2, and CAT gene variants and bone mineral density values in postmenopausal women: a genetic association analysis.
22058000 2011 Lack of association between catalase gene polymorphism (T/C exon 9) and susceptibility to vitiligo in a Turkish population.
21985966 2011 Reactive oxygen species downregulate catalase expression via methylation of a CpG island in the Oct-1 promoter.
21985133 2012 Decreased blood catalase activity is not related to specific beta-thalassemia mutations in Hungary.
21976670 2011 PEX5 protein binds monomeric catalase blocking its tetramerization and releases it upon binding the N-terminal domain of PEX14.
21968610 2012 Histone H4 deacetylation down-regulates catalase gene expression in doxorubicin-resistant AML subline.
21964540 2011 Catalase-like activity of human methemoglobin: a kinetic and mechanistic study.
21947853 2012 Catalase -262C>T polymorphisms in Hungarian vitiligo patients and in controls: further acatalasemia mutations in Hungary.
21921984 2011 Genetic polymorphisms of superoxide dismutases, catalase, and glutathione peroxidase in age-related cataract.
21829032 2011 The association between adult asthma and superoxide dismutase and catalase gene activity.
21827848 2011 Catalase rs769214 SNP in elderly malnutrition and during renutrition: is glucagon to blame?
21799178 2011 Overexpression of catalase in myeloid cells causes impaired postischemic neovascularization.
21689642 2011 Catalase overexpression in mammary cancer cells leads to a less aggressive phenotype and an altered response to chemotherapy.
21423176 2011 Analysis of the myosin-II-responsive focal adhesion proteome reveals a role for ?-Pix in negative regulation of focal adhesion maturation.
21417634 2011 Comparative proteomic analysis of cellular response of human airway epithelial cells (A549) to benzo(a)pyrene.
21295602 2011 Altered methanol embryopathies in embryo culture with mutant catalase-deficient mice and transgenic mice expressing human catalase.
21269460 2011 Initial characterization of the human central proteome.
21191398 2011 Human hair follicle and epidermal melanocytes exhibit striking differences in their aging profile which involves catalase.
21180245 2010 Polymorphism of catalase gene promoter in Romanian patients with diabetic kidney disease and type 1 diabetes.
21179281 2010 Association of the superoxide dismutase (V16A) and catalase (C262T) genetic polymorphisms with the clinical outcome of patients with acute paraquat intoxication.
21131394 2011 TGF-? regulates Nox4, MnSOD and catalase expression, and IL-6 release in airway smooth muscle cells.
21109199 2010 Targeted expression of catalase to mitochondria prevents age-associated reductions in mitochondrial function and insulin resistance.
21083503 2011 Effects of whole-body cryotherapy on a total antioxidative status and activities of antioxidative enzymes in blood of depressive multiple sclerosis patients.
21069346 2011 Pre-treatment with N-acetylcysteine upregulates superoxide dismutase 2 and catalase genes in cadmium-induced oxidative stress in the chick omphalocele model.
21054877 2010 Inflammation gene variants and susceptibility to albuminuria in the U.S. population: analysis in the Third National Health and Nutrition Examination Survey (NHANES III), 1991-1994.
21054578 2011 The polymorphism of catalase T/C codon 389 in exon 9 and vitiligo susceptibility: a meta-analysis.
21053180 2010 Evidence for an association between haptoglobin and MnSOD (Val9Ala) gene polymorphisms in essential hypertension based on a Brazilian case-control study.
20923778 2010 Inhibitors of catalase-amyloid interactions protect cells from beta-amyloid-induced oxidative stress and toxicity.
20878976 The effect of hydrogen peroxide-induced oxidative stress on leukocytes depends on age and physical training in healthy human subjects carrying the same genotypes of antioxidant enzymes' gene polymorphisms.
20851292 2010 Polymorphisms of superoxide dismutase, glutathione peroxidase and catalase genes in patients with post-transplant diabetes mellitus.
20732340 2010 Evaluation of the serum catalase and myeloperoxidase activities in chronic arsenic-exposed individuals and concomitant cytogenetic damage.
20727719 2010 Polymorphisms in genes involved in oxidative stress and their interactions with lifestyle factors on skin cancer risk.
20649881 2010 The association of -262C/T polymorphism in the catalase gene and delayed graft function of kidney allografts.
20643115 2010 Epistasis of oxidative stress-related enzyme genes on modulating the risks in oral cavity cancer.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20613769 2010 Promoter variant in the catalase gene is associated with vitiligo in Chinese people.
20494887 2010 [Effects of catalase gene (RS769217) polymorphism on energy homeostasis and bone status are gender specific].
20485444 2010 Common polymorphisms in ITGA2, PON1 and THBS2 are associated with coronary atherosclerosis in a candidate gene association study of the Chinese Han population.
20444272 2010 Gene polymorphisms against DNA damage induced by hydrogen peroxide in leukocytes of healthy humans through comet assay: a quasi-experimental study.
20416077 2010 Identification of type 2 diabetes-associated combination of SNPs using support vector machine.
20301895 2009 [Lack of association between metabolic and antioxidant gene polymorphisms (GSTM1, GSTT1, CAT, MnSOD, GPX1) and maternal quitting of smoking in pregnancy--preliminary results].
20194081 2010 Traffic-related air pollution and QT interval: modification by diabetes, obesity, and oxidative stress gene polymorphisms in the normative aging study.
20178365 2010 A proteome-wide perspective on peroxisome targeting signal 1(PTS1)-Pex5p affinities.
20110814 2010 Air pollution and homocysteine: more evidence that oxidative stress-related genes modify effects of particulate air pollution.
20109103 2010 Evaluation of gene polymorphisms in exercise-induced oxidative stress and damage.
20105444 2010 Oxidative stress in systemic lupus erythematosus: relationship to Th1 cytokine and disease activity.
20097730 2010 Antioxidant genes, diabetes and dietary antioxidants in association with risk of pancreatic cancer.
20082261 2009 Dietary carotenoid-rich pequi oil reduces plasma lipid peroxidation and DNA damage in runners and evidence for an association with MnSOD genetic variant -Val9Ala.
20078877 2010 Gene polymorphisms in association with emerging cardiovascular risk markers in adult women.
20049130 2009 Black carbon exposure, oxidative stress genes, and blood pressure in a repeated-measures study.
20020532 2010 A haplotype of the catalase gene confers an increased risk of essential hypertension in Chinese Han.
19949914 2011 Cigarette smoke condensate causes a decrease of the gene expression of Cu-Zn superoxide dismutase, Mn superoxide dismutase, glutathione peroxidase, catalase, and free radical-induced cell injury in SH-SY5Y human neuroblastoma cells.
19946888 2010 Defining the membrane proteome of NK cells.
19929244 2010 Polymorphisms in antioxidant defence genes and susceptibility to hepatocellular carcinoma in a Moroccan population.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19902075 2009 Activity of antioxidant enzymes in the wound in patients with deep burns.
19897742 2010 Shear stress stimulates nitric oxide signaling in pulmonary arterial endothelial cells via a reduction in catalase activity: role of protein kinase C delta.
19897513 2009 Functional variants in the catalase and myeloperoxidase genes, ambient air pollution, and respiratory-related school absences: an example of epistasis in gene-environment interactions.
19896490 2010 Low 8-oxo-7,8-dihydro-2'-deoxyguanosine levels and influence of genetic background in an Andean population exposed to high levels of arsenic.
19874574 2009 Genetical genomic determinants of alcohol consumption in rats and humans.
19863340 2009 Influence of the polymorphism in candidate genes on late cardiac damage in patients treated due to acute leukemia in childhood.
19855359 2009 Relation between functional polymorphism of catalase gene (-262C>T) and recurrent depressive disorder.
19787204 2009 Implications of antioxidant enzymes in human gastric neoplasms.
19731237 2009 Myeloperoxidase and superoxide dismutase 2 polymorphisms comodulate the risk of hepatocellular carcinoma and death in alcoholic cirrhosis.
19705749 2009 [Polymorphism of the genes for antioxidant defense enzymes and their association with the development of chronic obstructive pulmonary disease in the population of Bashkortostan].
19692168 2010 Genetic susceptibility to distinct bladder cancer subphenotypes.
19688952 2009 Catalase activity, serum trace element and heavy metal concentrations, vitamin A, vitamin D and vitamin E levels in hydatidiform mole.
19625176 2009 PTEN identified as important risk factor of chronic obstructive pulmonary disease.
19622717 2009 Effect modification by smoking on the association between genetic polymorphisms in oxidative stress genes and colorectal cancer risk.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19584075 2009 Novel susceptibility loci for second primary tumors/recurrence in head and neck cancer patients: large-scale evaluation of genetic variants.
19538885 2009 [Establishment of a multiplex ligation-dependent SNP genotyping method and its application in the detection of genes related to chemotherapeutic drugs in breast cancer].
19505917 2009 Lead exposure, polymorphisms in genes related to oxidative stress, and risk of adult brain tumors.
19497990 2009 Decreased catalase expression and increased susceptibility to oxidative stress in primary cultured corneal fibroblasts from patients with granular corneal dystrophy type II.
19479899 2009 Pex3p-dependent peroxisomal biogenesis initiates in the endoplasmic reticulum of human fibroblasts.
19424819 2010 CAT C-262T and GPX1 Pro198Leu polymorphisms in a Turkish population.
19409565 2009 Overexpression of antioxidant enzymes in ApoE-deficient mice suppresses benzo(a)pyrene-accelerated atherosclerosis.
19399816 2009 Cellular mRNA expressions of anti-oxidant factors in the blood of preeclamptic women.
19373626 2009 Tobacco smoking, fruit and vegetable intake modify association between -21A>T polymorphism of catalase gene and risk of bronchial asthma.
19341793 2009 Overexpression of catalase delays G0/G1- to S-phase transition during cell cycle progression in mouse aortic endothelial cells.
19336475 2009 Integrated associations of genotypes with multiple blood biomarkers linked to coronary heart disease risk.
19274593 2009 An association study between catalase -262C>T gene polymorphism, sodium-lithium countertransport activity, insulin resistance, blood lipid parameters and their response to atorvastatin, in Greek dyslipidaemic patients and normolipidaemic controls.
19255063 2009 Oxidative stress-related genotypes, fruit and vegetable consumption and breast cancer risk.
19254215 2009 [Association of genetic factors with clinical peculiarities of hypertensive disease in patients with burdened familial anamnesis].
19242068 2009 Genetic polymorphisms modifying oxidative stress are associated with disease activity in rheumatoid arthritis patients.
19172437 2009 Relationship between erythrocyte catalase and serum adenosine deaminase activities in eclampsia.
19170196 2009 Polymorphisms in innate immunity genes and lung cancer risk in Xuanwei, China.
19124506 2009 Common genetic variation in candidate genes and susceptibility to subtypes of breast cancer.
19092850 2009 Role of catalase in monocytic differentiation of U937 cells by TPA: hydrogen peroxide as a second messenger.
19064360 2008 Asbestosis and catalase genetic polymorphism.
19050255 2008 Transduction with the antioxidant enzyme catalase protects human T cells against oxidative stress.
18977241 2008 Oxidative stress, telomere length and biomarkers of physical aging in a cohort aged 79 years from the 1932 Scottish Mental Survey.
18949620 2008 Catalase activity and arsenic sensitivity in acute leukemia.
18936436 2009 Prevalence in the United States of selected candidate gene variants: Third National Health and Nutrition Examination Survey, 1991-1994.
18930811 2008 Severe oxidative damage in multiple sclerosis lesions coincides with enhanced antioxidant enzyme expression.
18682580 2008 Oxidative response gene polymorphisms and risk of adult brain tumors.
18634817 2008 Progeric effects of catalase inactivation in human cells.
18606005 2008 Detection of catalase as a major protein target of the lipid peroxidation product 4-HNE and the lack of its genetic association as a risk factor in SLE.
18485895 2008 Sirt1 protects against oxidative stress-induced renal tubular cell apoptosis by the bidirectional regulation of catalase expression.
18483329 2008 Effect modification by catalase genotype suggests a role for oxidative stress in the association of hormone replacement therapy with postmenopausal breast cancer risk.
18469277 2008 Gene polymorphisms of oxidative stress enzymes: prediction of elderly renutrition.
18423055 2008 Gene polymorphisms of superoxide dismutases and catalase in diabetes mellitus.
18415766 Increased levels of autoantibodies against catalase and superoxide dismutase associated with oxidative stress in patients with rheumatoid arthritis and systemic lupus erythematosus.
18379038 2008 Presence and some characteristics of peroxisomes in immortalized human trophoblast cells.
18368408 2008 Catalase -262C>T polymorphism in systemic lupus erythematosus in Poland.
18353692 2008 Genetic association study of polymorphisms in the catalase gene with the risk of osteonecrosis of the femoral head in the Korean population.
18312938 Altered antioxidant capacity in human renal cell carcinoma: role of glutathione associated enzymes.
18248894 2008 Short arm of chromosome 11 and sporadic Alzheimer's disease: catalase and cathepsin D gene polymorphisms.
18171680 2008 Down-regulation of catalase and oxidative modification of protein kinase CK2 lead to the failure of apoptosis repressor with caspase recruitment domain to inhibit cardiomyocyte hypertrophy.
18088087 2008 Phosphoproteome of resting human platelets.
18048809 2008 Ozone, oxidant defense genes, and risk of asthma during adolescence.
17937824 2007 Retrospective analysis of main and interaction effects in genetic association studies of human complex traits.
17879952 2008 Catalase overexpression impairs TNF-alpha induced NF-kappaB activation and sensitizes MCF-7 cells against TNF-alpha.
17850515 2007 Association of catalase T/C exon 9 and glutathione peroxidase codon 200 polymorphisms in relation to their activities and oxidative stress with vitiligo susceptibility in Gujarat population.
17696155 2007 Catalase overexpression does not impair extensor digitorum longus muscle function in normal mice.
17693525 2007 Pseudoxanthoma elasticum: genetic variations in antioxidant genes are risk factors for early disease onset.
17646900 2008 Antioxidant enzyme activities, lipid peroxidation, and total antioxidant status in children with Henoch-Schönlein purpura.
17634480 2007 Common germline genetic variation in antioxidant defense genes and survival after diagnosis of breast cancer.
17601350 2007 A genetic association analysis of cognitive ability and cognitive ageing using 325 markers for 109 genes associated with oxidative stress or cognition.
17577741 2007 Effect of C111T polymorphism in exon 9 of the catalase gene on blood catalase activity in different types of diabetes mellitus.
17567781 2007 Association between variations in CAT and noise-induced hearing loss in two independent noise-exposed populations.
17567676 2007 Polymorphisms and functional activity in superoxide dismutase and catalase genes in smokers with COPD.
17566139 Fatty acids decrease catalase activity in human leukaemia cell lines.
17549373 2007 Association of polymorphisms in myeloperoxidase and catalase genes with precancerous changes in the gastric mucosa of patients at inner-city hospitals in New York.
17548672 2007 Polymorphisms in oxidative stress-related genes are not associated with prostate cancer risk in heavy smokers.
17264407 2006 The catalase -262C/T promoter polymorphism and diabetic complications in Caucasians with type 2 diabetes.
17213227 2007 Markers of oxidative stress in the skeletal muscle of patients on haemodialysis.
17209132 2007 Associations of catalase gene polymorphisms with bone mineral density and bone turnover markers in postmenopausal women.
17171548 2007 Markers of antioxidant defence system and lipid peroxidation in peripheral blood of female patients with chronic idiopathic urticaria.
17145829 2006 Polymorphisms in genes related to oxidative stress (CAT, MnSOD, MPO, and eNOS) and acute toxicities from radiation therapy following lumpectomy for breast cancer.
17053817 2007 Protection of normal human reconstructed epidermis from UV by catalase overexpression.
17005595 2006 Age-dependent changes in the expression of superoxide dismutases and catalase are associated with ultrastructural modifications in human granulosa cells.
16956821 2006 Polymorphisms in the oxidative stress genes, superoxide dismutase, glutathione peroxidase and catalase and risk of non-Hodgkin's lymphoma.
16868544 2006 Interactions between genes involved in the antioxidant defence system and breast cancer risk.
16781659 2006 Molecular organization of peroxisomal enzymes: protein-protein interactions in the membrane and in the matrix.
16775184 2006 Associations between catalase phenotype and genotype: modification by epidemiologic factors.
16773213 2007 Lipid peroxidation and activity of some antioxidant enzymes in patients with glioblastoma and astrocytoma.
16729966 2006 Analysis of allelic variants in the catalase gene in patients with the skin depigmenting disorder vitiligo.
16644728 2006 Protective effects of catalase overexpression on UVB-induced apoptosis in normal human keratinocytes.
16630078 2006 Association study between catalase gene polymorphisms and the susceptibility to vitiligo in Korean population.
16600249 2007 Superoxide dismutase and catalase inhibit oxidized low-density lipoprotein-induced human aortic smooth muscle cell proliferation: role of cell-cycle regulation, mitogen-activated protein kinases, and transcription factors.
16586065 2006 Cardiac overexpression of catalase rescues cardiac contractile dysfunction induced by insulin resistance: Role of oxidative stress, protein carbonyl formation and insulin sensitivity.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
16523188 2006 The 262T>C promoter polymorphism of the catalase gene is associated with diabetic neuropathy in type 1 diabetic Russian patients.
16504657 Hypoxanthine as a graft ischemia marker stimulates catalase activity in the renal vein during reperfusion in humans.
16482509 2006 Binding specificity of Toll-like receptor cytoplasmic domains.
16467073 2006 Functional variants of antioxidant genes in smokers with COPD and in those with normal lung function.
16453382 No evidence for a major effect of two common polymorphisms of the catalase gene in type 1 diabetes susceptibility.
16424062 2006 Tagging single-nucleotide polymorphisms in antioxidant defense enzymes and susceptibility to breast cancer.
16387755 2006 Mitochondrial localization of catalase provides optimal protection from H2O2-induced cell death in lung epithelial cells.
16385446 2006 A testing framework for identifying susceptibility genes in the presence of epistasis.
16298864 2005 Association of CAT polymorphisms with catalase activity and exposure to environmental oxidative stimuli.
16236267 2005 Proteomic analysis of SUMO4 substrates in HEK293 cells under serum starvation-induced stress.
16210410 2005 Differential expression profiling of membrane proteins by quantitative proteomics in a human mesenchymal stem cell line undergoing osteoblast differentiation.
16204228 2005 Catalase plays a critical role in the CSF-independent survival of human macrophages via regulation of the expression of BCL-2 family.
16192345 2005 Associations between breast cancer risk and the catalase genotype, fruit and vegetable consumption, and supplement use.
16098030 2005 H2O2 accumulation by catalase reduction changes MAP kinase signaling in aged human skin in vivo.
16076760 2005 Genetic polymorphisms of oxidative and antioxidant enzymes and arsenic-related hypertension.
16047490 2005 Genetic polymorphisms of GSTT1, GSTM1, GSTP1, MnSOD, and catalase in nonhereditary chronic pancreatitis: evidence of xenobiotic stress and impaired antioxidant capacity.
16026777 2005 Thiobarbituric acid reactive substances, seric superoxide dismutase and catalase activities in healthy subjects.
15988600 2006 Catalase and PPARgamma2 genotype and risk of rheumatoid arthritis in Koreans.
15934434 2005 Catalase and PPARgamma2 genotype and risk of systemic lupus erythematosus in Koreans.
15870505 Adenovirus-mediated gene transfer of superoxide dismutase and catalase decreases restenosis after balloon angioplasty.
15800961 2005 Detection of a novel familial catalase mutation (Hungarian type D) and the possible risk of inherited catalase deficiency for diabetes mellitus.
15774926 2005 Association study of detoxification genes in age related macular degeneration.
15735318 2005 Polymorphisms in the promoter region of catalase gene and essential hypertension.
15733034 2005 Catalase regulates cell growth in HL60 human promyelocytic cells: evidence for growth regulation by H(2)O(2).
15705913 2005 Polymorphisms in genes related to oxidative stress (MPO, MnSOD, CAT) and survival after treatment for breast cancer.
15556604 2004 SHP2 binds catalase and acquires a hydrogen peroxide-resistant phosphatase activity via integrin-signaling.
15528999 2004 Deregulation of catalase, not MnSOD, is associated with necrotic death of p53-defective DF-1 cells under antimycin A-induced oxidative stress.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15472150 2004 The catalase -262C/T promoter polymorphism and aging phenotypes.
15203188 2004 Ceramide-induced apoptosis: role of catalase and hepatocyte growth factor.
15182856 2004 Catalase binds Grb2 in tumor cells when stimulated with serum or ligands for integrin receptors.
15133753 A new type 1 diabetes susceptibility locus containing the catalase gene (chromosome 11p13) in a Russian population.
15131792 2004 Association of antioxidant enzyme gene polymorphisms and glutathione status with severe acute pancreatitis.
15125229 [Search for the association of polymorphic markers for genes coding for antioxidant defense enzymes, with development of diabetic polyneuropathies in patients with type 1 diabetes mellitus].
14962975 2004 High levels of catalase and glutathione peroxidase activity dampen H2O2 signaling in human alveolar macrophages.
14710363 Increased activity of catalase in tumor cells overexpressing IGFBP-2.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14580687 2003 Susceptibility to arsenic-induced hyperkeratosis and oxidative stress genes myeloperoxidase and catalase.
13904105 1961 The frequency in Japan of carriers of the rare "recessive" gene causing acatalasemia.
12950161 2003 Catalase is regulated by ubiquitination and proteosomal degradation. Role of the c-Abl and Arg tyrosine kinases.
12838770 [The study of the antioxidant enzymes in erythrocytes in lung diseases].
12824748 2003 [Effects of genetic polymorphisms of ethanol-metabolizing enzymes on alcohol drinking behaviors].
12777400 2003 Catalase activity is regulated by c-Abl and Arg in the oxidative stress response.
12730222 2003 UVB light stimulates production of reactive oxygen species: unexpected role for catalase.
12665801 2003 Exploring proteomes and analyzing protein processing by mass spectrometric identification of sorted N-terminal peptides.
12606529 2003 The response of antioxidant genes to hyperglycemia is abnormal in patients with type 1 diabetes and diabetic nephropathy.
12603857 2003 Antioxidant enzyme activity in human stratum corneum shows seasonal variation with an age-dependent recovery.
12516882 2002 Acute phase immune response to exercise coexists with decreased neutrophil antioxidant enzyme defences.
12487379 2002 Regulation of catalase enzyme activity by cell signaling molecules.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12469627 2002 [Associative analysis of the connection between mutation C1167T in the catalase gene and polymorphic marker D6S392 nearby the Mn-dependent superoxide dismutase gene with diabetic microangiopathies].
12468545 2003 Catalase protects HepG2 cells from apoptosis induced by DNA-damaging agents by accelerating the degradation of p53.
12447480 2002 Activity of glutathione-metabolizing and antioxidant enzymes in malignant and benign tumors of human lungs.
12372460 2002 Involvement of catalase in the endometrium of patients with endometriosis and adenomyosis.
12231449 2002 An association study of a functional catalase gene polymorphism, -262C-->T, and patients with Alzheimer's disease.
12165738 2002 Activity of superoxide dismutase and catalase and the level of lipid peroxidation products reactive with TBA in patients with psoriasis.
12032677 2002 Control of ceramide-induced apoptosis by IGF-1: involvement of PI-3 kinase, caspase-3 and catalase.
11907164 2002 Adenovirus-mediated overexpression of catalase in the cytosolic or mitochondrial compartment protects against toxicity caused by glutathione depletion in HepG2 cells expressing CYP2E1.
11837458 2002 Genetic association of the catalase gene (CAT) with vitiligo susceptibility.
11729237 2001 Manganese superoxide dismutase attenuates Cisplatin-induced renal injury: importance of superoxide.
11728823 2001 Transduction of human catalase mediated by an HIV-1 TAT protein basic domain and arginine-rich peptides into mammalian cells.
11479740 2001 A polymorphism in the promoter region of catalase is associated with blood pressure levels.
11313354 2001 Human alveolar macrophages and granulocyte-macrophage colony-stimulating factor-induced monocyte-derived macrophages are resistant to H2O2 via their high basal and inducible levels of catalase activity.
11182520 2001 A common functional C-T substitution polymorphism in the promoter region of the human catalase gene influences transcription factor binding, reporter gene transcription and is correlated to blood catalase levels.
11134921 2001 Structure of tetragonal crystals of human erythrocyte catalase.
11106583 2000 Onset of maternal arterial blood flow and placental oxidative stress. A possible factor in human early pregnancy failure.
10960480 2000 Catalase-less peroxisomes. Implication in the milder forms of peroxisome biogenesis disorder.
10666617 2000 Structure of human erythrocyte catalase.
10656833 2000 Active and inhibited human catalase structures: ligand and NADPH binding and catalytic mechanism.
10567403 1999 Localization of a portion of extranuclear ATM to peroxisomes.
10567208 1999 Amyloid-beta binds catalase with high affinity and inhibits hydrogen peroxide breakdown.
10514471 1999 Characterization of human and murine PMP20 peroxisomal proteins that exhibit antioxidant activity in vitro.
10488055 1999 Overexpression of human catalase inhibits proliferation and promotes apoptosis in vascular smooth muscle cells.
10096042 1998 The expression of key oxidative stress-handling genes in different brain regions in Alzheimer's disease.
9848047 Recombinant human growth hormone decreases lung and liver tissue lipid peroxidation and increases antioxidant activity after thermal injury in rats.
9818873 1998 Defective peroxisome biogenesis with a neuromuscular disorder resembling Werdnig-Hoffmann disease.
9053548 1995 Immunocytochemical localization of peroxisomal proteins in human liver and kidney.
8479912 1993 Protection of human endothelial cells from oxidant injury by adenovirus-mediated transfer of the human catalase cDNA.
8282800 1994 Vulnerability of the human airway epithelium to hyperoxia. Constitutive expression of the catalase gene in human bronchial epithelial cells despite oxidant stress.
7882369 1995 A human erythrocyte-derived growth-promoting factor with a wide target cell spectrum: identification as catalase.
7829101 1994 Isolation of novel and known genes from a human fetal cochlear cDNA library using subtractive hybridization and differential screening.
6548744 1984 Isolation of human fibroblast catalase cDNA clones. Sequence of clones derived from spliced and unspliced mRNA.
6252821 1980 Regional assignment of catalase (CAT) gene to band 11p13. Association with the aniridia-Wilms' tumor-Gonadoblastoma (WAGR) complex.
3944256 1986 Erythrocyte catalase. A somatic oxidant defense?
3755526 1986 cDNA sequence coding for human kidney catalase.
3755525 1986 Isolation and characterization of the human catalase gene.
2991908 1985 Linkage map of the short arm of human chromosome 11: location of the genes for catalase, calcitonin, and insulin-like growth factor II.
2895531 1988 Immunocytochemical demonstration of peroxisomal enzymes in human kidney biopsies.
2308162 1990 Molecular analysis of human acatalasemia. Identification of a splicing mutation.
2268310 1990 Molecular analysis of an acatalasemic mouse mutant.
1551654 1992 Detection of a common mutation of the catalase gene in Japanese acatalasemic patients.