Property Summary

NCBI Gene PubMed Count 369
PubMed Score 1666.16
PubTator Score 875.21

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (9)

Disease Target Count P-value
lung carcinoma 2844 2.3e-08
osteosarcoma 7933 6.9e-08
psoriasis 6685 1.6e-03
non primary Sjogren syndrome sicca 840 1.5e-02
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Disease Target Count Z-score Confidence
Cardiovascular system disease 194 0.0 2.0
Type 2 diabetes mellitus 192 0.0 1.0
Disease Target Count Z-score Confidence
Epilepsy 346 0.0 4.0

Expression

  Differential Expression (4)

Disease log2 FC p
psoriasis 1.200 1.6e-03
osteosarcoma 1.609 6.9e-08
non primary Sjogren syndrome sicca 1.100 1.5e-02
lung carcinoma 1.500 2.3e-08

Synonym

Accession P41180 Q13912 Q16108 Q16109 Q16110 Q16379 Q2M1T0 Q4PJ19 CaSR
Symbols CAR
FHH
FIH
HHC
EIG8
HHC1
NSHPT
PCAR1
GPRC2A
HYPOC1

Gene

PDB

5FBH   5FBK   5K5S   5K5T  

  TechDev Info (1)

Protein-protein Interaction (290)

GNAT3   GRM8   CORT   F2RL2   P2RY10   CXCR6   CCL21   CXCL11   FFAR1   FFAR3   NPFF   GRM6   CCL25   CCL16   FFAR2   MLNR   ADCY6   GNRH2   GALR2   HCRT   HCRTR1   HCRTR2   CXCL13   KALRN   ADCY3   ADCY9   GALR3   GABBR2   TRIO   S1PR2   UTS2   ADCY5   NTSR2   GNA14   S1PR4   F2   C3   C5   KNG1   GNRH1   OXT   AVP   POMC   PENK   PDYN   GCG   PPY   NPY   GAST   PPBP   PF4   CXCL10   GNAI2   APP   EDN1   CCK   GRP   GNAI3   NMB   CXCL1   NPS   SAA1   ADORA3   PYY   CXCL8   MLN   CCL5   EDN3   DRD2   ADRA2C   GNAZ   CXCL2   CXCL3   TAC1   PMCH   TRH   EDN2   TACR2   S1PR1   FPR1   CNR1   TBXA2R   DRD4   GAL   EDNRB   CXCR1   CXCR2   FPR3   FPR2   EDNRA   TACR1   PTAFR   ACKR3   F2R   NPY1R   PIK3R1   HTR2C   NMBR   TACR3   GNA11   GRPR   OXTR   GNA15   SSTR1   SSTR2   GNRHR   NTSR1   NTS   SSTR4   CCKAR   CCKBR   CCR1   CCR7   CXCR5   SSTR3   GRK5   CNR2   TRHR   PTGER1   SSTR5   HRH1   OPRM1   DRD3   AVPR1A   ADCY8   OPRD1   OPRK1   OPRL1   P2RY2   GRM5   CCR2   PIK3CA   CXCL5   PTGFR   PTGER3   LPAR6   CCR10   GPR4   XCR1   GALR1   GCGR   P2RY1   AVPR1B   XCL1   MTNR1A   CXCL12   NPBWR1   NPBWR2   NMU   PIK3CG   HCAR3   NPY2R   MTNR1B   CXCR3   GNAQ   NPY4R   P2RY4   CCR3   CCR4   CCR5   CCR6   CCR8   CCR9   ADCY7   F2RL1   CCL23   PROK1   TAS2R38   TAS2R39   TAS2R40   TAS2R41   TAS2R43   TAS2R31   TAS2R45   TAS2R46   TAS2R30   TAS2R19   TAS2R20   TAS2R50   TAS2R60   GNG2   CXCR4   SST   GNB1   GNAI1   CCL20   CXCL6   QRFP   PLCB2   PLCB3   GNA12   CXCL9   ADCY2   ADCY1   GRM1   GPR17   PNOC   GPR18   GNA13   GRM2   GRM7   GRM3   GRM4   P2RY6   PLCB4   P2RY14   LTB4R   KISS1   GPR68   NPY5R   NMS   GPRC6A   PIK3R6   NPSR1   UTS2B   TAS2R42   ARHGEF25   MT-RNR2   GPR65   NPW   PROKR2   ADCY4   NPB   PROKR1   HCAR2   OXER1   RXFP4   RLN3   PIK3R5   LPAR1   GHSR   ARHGEF1   KISS1R   MCHR2   P2RY11   QRFPR   OXGR1   GNRHR2   F2RL3   S1PR3   GPER1   LPAR4   MCHR1   CCL19   P2RY13   SUCNR1   HCAR1   NMUR2   NPFFR1   LPAR5   S1PR5   P2RY12   CXCL16   HRH4   NMUR1   LPAR2   PROK2   LTB4R2   PLCB1   CCL28   HEBP1   CYSLTR2   RXFP3   TAS2R16   TAS2R14   TAS2R13   TAS2R10   TAS2R9   TAS2R8   TAS2R7   TAS2R5   TAS2R4   TAS2R3   TAS2R1   ARHGEF12   XCL2   GABBR1   GHRL   LPAR3   TAC3   OPN4   UTS2R   GPR132   CYSLTR1   GPR55   CCL27   HRH3   INSL5   NPFFR2   PTGDR2  

Gene RIF (364)

PMID Text
27050483 CaSR-induced constitutive macropinocytosis facilitates the sentinel function of macrophages, promoting the efficient delivery of ligands to cytosolic pattern-recognition receptors.
26994139 These findings demonstrate that CaSR-targeted compounds can rectify signaling disturbances caused by germline and somatic Galpha11 mutations, which respectively lead to calcium disorders and tumorigenesis; and that ADH2-causing Galpha11 mutations induce non-constitutive alterations in MAPK signaling.
26764418 A novel naturally occurring deletion mutation within the CASR that apparently arose de novo in the father of the Autosomal dominant hypocalcemia proband.
26665756 No association was found between multiple kidney stones and polymorphisms of genes encoding KL, VDR, CASR.
26654249 There is no association between CASR SNP rs1801725, although an association between altered calcium levels and gastrointestinal motility could not be ruled out.
26436544 Aortic smooth muscle cells under static or strained conditions were exposed to CaSR agonists, R568, and CaSR silencing and over-expression. High Ca reduced CaSR expression. Cyclic strain or R568 prevented this. CaSR silencing enhanced calcification.
26431875 the S170T mutation induces a marked increase in CaSR sensitivity to [Ca(2+)]e and imply the allosteric regulation of the CaSR by aromatic amino acids
26317416 these studies suggest that 14-3-3 binding at the carboxyl terminus provides an important buffering mechanism to increase the intracellular pool of CaSR available for signaling-evoked trafficking
26252839 Results suggest that the G allele and the homozygous GG genotype of the CaSR rs17251221 polymorphism are protective against ovarian cancer and represent low risk for it.
26166472 Letter: overrepresentation of rare CASR coding variants in young French patients with idiopathic chronic pancreatitis.
26158657 the identification of a novel heterozygous loss-of-function mutation of the CASR gene in three siblings with familial hypocalciuric hypercalcaemia
26153034 Downregulation of CaSR may contribute to the prevention or suppression of tumor outgrowth in gastric cancer.
26107257 Rs1801725 (Ala986-Ser), rs1042636 (Arg990Gly) of CaSR gene and rs219778, rs219780 (Thr229Thr) of CLDN14 gene were significantly associated with kidney stone disease in patients from the Eastern part of India.
25986659 CaSR activation elevates visceral preadipocyte proliferation.
25977473 the activation of CaSR in the collecting duct prevents the cyclic AMP-dependent increase in AQP2-phosphorylation at S256 and water permeability, counteracting the short-term vasopressin response.
25972035 Considering the high allele frequency and significance level of the rs13068893C>G in the CASR gene, this SNP may have a key role in regulating the serum calcium level.
25910996 These studies have revealed new insights into the CaSR signalling pathway and its role in regulating extracellular homeostasis and the etiology of parathyroid diseases--{REVIEW}
25904744 Calcium-sensing receptor has a role in airway hyperresponsiveness and inflammation in allergic asthma
25786244 Authors investigated whether common CASR gene variants are predictors for aortic and coronary artery calcification or influence risk factors such as serum calcium, phosphate and glucose concentrations in RTRs.
25766501 Novel activating mutation of CASR has been described in a 3-generation family with autosomal dominant hypocalcaemia.
25758239 Both vitamin D and calcium are needed for protection against malignant transformation of the colon and that their effect is modulated by the presence of a functional CaSR.
25705702 This meta-analysis revealed that the G allele of CaSR R990G polymorphism increases susceptibility to urolithiasis and hypercalciuria. The A986S and Q1011E polymorphisms were associated with urolithiasis and hypercalciuria in specific populations.
25701780 The cholesterol-binding domains localize the CaSR dimers to lipid rafts.
25701758 results demonstrate a critical tumor suppressive role of CaSR in the colon. Restoration of CaSR expression and function is linked to regulation of the balance between proliferation, differentiation, and apoptosis
25695075 patients with vitamin D deficiency bearing the GG genotype of R990G SNP have higher plasma iPTH levels and lower serum calcium in comparison with the AG and AA genotype subjects
25631355 activated CaR affects intracellular pathways modulating NKCC2 activity rather than NKCC2 intracellular trafficking in renal cells, and throw further light on the pathological role played by active CaR mutants in Bartter syndrome type 5.
25420019 Data show that the loss-of-function mutations, L173P and P221Q, but not the gain-of-function mutations, L173F and P221L, alter the cooperativity of the Ca(2+)-sensing receptor (CaSR).
25401741 The intron 4 polymorphism in CASR is a factor in diabetic nephropathy and diabetes mellitus.
25382680 CaSR-mediated increase in [Ca2+]i probably modulates cytoskeleton organization and gene expression via transcription factor CREB
25365856 A newborn case of NSHPT with a novel mutation which has never been described before.
25331955 CaSR activation triggers Ca(2+)-dependent duodenal bicarbonate secretion
25305020 findings provide new insights into the mechanisms by which Ca(2+) and amino acids regulate the CaSR and may pave the way for exploration of the structural properties of CaSR and other members of family C of the GPCR superfamily.
25292184 Case of a novel inactivating point mutation of CaSR gene that determines an atypical clinical presentation of FHH, characterized by hypercalcemia, hypercalciuria and inadequate normal PTH levels.
25270285 CaSR rs17251221 polymorphism is associated with susceptibility to hepatocellular carcinoma.
25134967 Data indicate that the total calcium-sensing receptor (CaSR) expression in circulating monocytes was significantly higher in rheumatoid arthritis (RA) patients with severe coronary artery calcification (CAC) than in patients with mild-to-moderate CAC.
25104082 CaSR mutations are associated with primary hyperparathyroidism.
25091521 evaluated CaSR mutations as a cause of disease in selected patients with idiopathic or familial parathyroid disorder; characterized novel 132 V mutation leading to familial hypercalciuric hypercalcemia
25080008 CaSR selects for specific signalling pathways via the proximal C-terminus and key residues in intralopps 2 and 3.
25069966 Authors summarize the role of CaSR in digestive physiology and pathophysiology, for example, the inactivation or mutation of the CaSR gene usually leads to one of several disorders of calcium metabolism. [Review]
25063217 CaSR is involved in the pulmonary vascular remodeling and pulmonary hypertension by promoting phenotypic modulation of small pulmonary arteries.
25039540 the severity of clinical neurological symptoms was inversely related to serum calcium levels and a high prevalence of renal calcifications and/or basal ganglia calcifications in children with Autosomal dominant hypocalcaemia
25019182 Calcium-sensing receptor gene (CaSR) might be a strong component of the complex genetic background regulating calcium excretion and stone formation in kidney
24948534 Exogenous Abetas stimulate the normal cortical adult astrocytes to produce and secrete VEGF-A through a CaSR-mediated mechanism. Abetas in the AD brain may make astrocytes into multi-agent AD-driving "machines" via a CaSR signaling mechanism(s).
24947037 Despite comprehensive cardiometabolic phenotyping, no alterations in myocardial function, lipid distribution, or glucose metabolism were observed in familial hypocalciuric hypercalcemia.
24930987 under-expressed in gestational diabetes mellitus compared to healthy placentas
24905090 CaSR activation mediates Ca2+ influx and cell proliferation via TRPC3 and TRPC6 in human mesangial cells
24854525 Neonatal severe primary hyperparathyroidism associated with biallelic Gly768Val mutations of the CASR in two siblings with severe hypercalcemia and hyperparathyroidism and their clinically and biochemically normal heterozygous parents was transmitted as an autosomal recessive disorder in this family
24842051 The roles of the calcium-sensing receptor (CaSR) and L-type voltage-dependent calcium channel (L-VDCC) in the proliferation and osteogenic differentiation of a calcium-exposed periodontal ligament stem/progenitor cells, were investigated .
24832896 We conclude that the simultaneous presence of the minor allele at rs1501899 and Arg990Gly may amplify the kidney stone risk in primary hyperparathyroidism patients.
24770445 It is upregulated in pulmonary arterial smooth muscle cells (PASMCs) from patients with idiopathic PAH (IPAH). The upregulated CaSR is necessary for the enhanced Ca2+ signaling and the augmented cell proliferation in PASMCs from IPAH patients.
24691920 Calcium-sensing receptor silencing in colorectal cancer is associated with promoter hypermethylation and loss of acetylation on histone 3.
24584713 CaSR was downregulated during the carcinogenesis of breast cancer, and it is an independent prognostic marker for the survival of breast cancer patients.
24559921 Data suggest that activation of CASR in pancreatic beta cells has multiple effects including altering cadherin-based cell-cell adhesion, cell-to-cell communication, and expression/function of potassium and voltage-dependent calcium channels. [REVIEW]
24517148 CaSR mutations causing mild functional impairment can lead to familial hypocalciuric hypercalcemia, even in homozygous patients.
24481145 The rs17251221 single nucleotide polymorphism of CaSR is a risk factor associated with breast cancer susceptibility, as well as a prognostic indicator.
24455835 This review article describes distribution of polymorpic variants of calcium-sensing receptor with respect to secondary hyperparathyroidism in dialyzed patients with chronic renal failure.
24454825 A novel functional role for RAMP1 in regulation of CaSR signalling in addition to its known role in receptor trafficking, is reported.
24336654 Calcium oscillations induced by activation of the Ca2+-sensing receptor in response to an increase in extracellular or exposure to the calcimimetic R-568 result from negative feedback involving PKCalpha-mediated phosphorylation of the CaR at Thr(888).
24297799 The functional activity of mutant CaSR determines the serum Mg(2+) level, renal Mg(2+) handling, and intact PTH in patients with autosomal dominant hypocalcemia
24264723 Our results suggest that the CaSR interacts with ZnR/GPR39 and thereby regulates its activity. in PC3 cells ZnR/GPR39 is required for mediating the Zn(2+) -dependent activation of MAPK and PI3K, pathways leading to enhanced cell growth
24244430 cells expressing activating CaSR variants showed a significant increase in SERCA activity and expression and a reduced PMCA expression.
24238055 CaSR is expressed by parathyroid cells and thyroid C-cells (from which medullary thyroid carcinoma [MTC] is derived). A molecular imaging agent localizing to the CaSR could improve the detection of parathyroids and MTC preoperatively or intraoperatively.
24217682 Calcimimetic-dependent increase in biosynthesis and activation of the CaSR in vascular smooth muscle probably plays a key role in the protection against calcium-induced vascular calcinosis.
24133354 Five SNPs in the CASR gene (c.2205G>A, c.2824G>A [rs76327999], c.2956G > T [rs1801725], c.2968A > G [rs1042636], and c.3031G > C [rs1801726]) were identified from six subjects.
24120622 results suggest that the CaSR R990G polymorphism is associated with increased risk of HTG, especially in obese Chinese, and may be a potential genetic predictor of diseases related to HTG
24101400 A nearly 1.5-fold higher expression of CaSR (surf) on the peripheral blood monocytes of individuals with diabetes and peripheral arterial disease manifests during post-transcription stage.
24098349 total and surface calcium-sensing receptor expression in monocytes
24013548 These observations suggest that the CaSR participates in regulating tight junctions assembly
23946278 The R990G polymorphism is most frequently present in the Chinese population and among patients with primary hyperparathyroidism
23917029 the CaSR in the kidney controls calcium reabsorption and excretion and subsequently affects blood calcium concentration--{REVIEW}
23913941 Methylation-mediated silencing of VDR and CASR promoter does not appear to be associated with reduced expression, indicating the involvement of other factors in specific suppression of VDR and CASR in parathyroid adenomas.
23864702 Minor allele at rs6776158 may predispose to calcium stones by decreasing transcriptional activity of the CaSR gene promoter 1 and CaSR expression in kidney tubules.
23860708 For rs17251221 there was a mean difference in serum calcium of 0.05 mmol/L between major and minor homozygote genotypes.
23856265 review of disorders associated with CaSR mutations and autoantibodies
23817301 Case Report: homozygous CASR mutation causing neonatal hypercalcemia resistant to cincalcet treatment.
23764372 Data suggest that lifelong hypercalcemia due to familial hypocalciuric hypercalcemia (type 1) is not associated with an impaired quality of life; study details mutations in CASR in 50 subjects in Denmark.
23756480 Genome-wide association studies identify CASR mutation releated to juvenile myoclonic epilepsy.
23740560 CaSR functions not through its expression, but rather through allosteric regulation in obese individuals.
23674327 Methylation and demethylation of the CaSR gene promoter underlie CaSR expression.
23639611 required for response to TGFbeta in colonic epithelial cells
23569134 These results indicate that downregulation of CaSR, and a higher rate of proliferation over apoptosis, could contribute to the pathological progression of secondary hyperparathyroidism.
23555732 Subjects with lower calcium intake exhibited a higher colorectal cancer risk compared with subjects with the same genotype who had higher calcium intake
23552627 Protein expression of calcium-sensing receptor ( and vitamin D receptor, fibroblast growth factor receptor and alpha-klotho) are all increased in parathyroid glands from secondary hyperparathyroidism patients.
23533647 Polymorphisms in the calcium-sensing receptor gene are associated with clinical outcome of neuroblastoma.
23372019 Three mutations (G(670)R, P(748)R, and L(773)R) altered the binding affinity of allosteric modulators to the CaSR, and 3 mutations (V(817)I, L(773)R, and E(767)K) altered the cooperativity between the allosteric modulator and Ca(2+)(o).
23334987 Impaired protein expression of CaSR and VDR seem to be involved in the development of primary hyperparathyroidism.
23300272 Upregulated expression & enhanced function of CaSR in pulmonary artery smooth myocytes are involved in the development of sustained pulmonary vasoconstriction & pulmonary vascular remodeling in patients with idiopathic pulmonary hypertension.
23287098 Report sparse expression of CaS receptors in pregnant human myometrium and effect of ligands on contractility of human pregnant endometrium.
23271661 Extracellular Ca2+ activates the NLRP3 inflammasome via CaSR and GPRC6A.
23269116 Exposure of intestinal epithelia to the eosinophil granule protein analog polyargining stimulates CaSR-dependent ERK phosphorylation and epithelial-mediated collagen lattice contraction.
23228129 CaSR plays important roles in cellular functions including the control of cellular proliferation, differentiation and apoptosis. (Review)
23169696 report of 2 novel CASR mutations affecting the same amino acid (p.N802); one causes autosomal dominant hypocalcemia and the other atypical hypocalciuric hypercalcemia; the asparagine at amino acid position 802 appears to be essential for activity of CASR protein and is implicated in mechanism of CASR signaling
23125333 CASR genetic variation may play a role in prostatic cncer progression and mortality.
23108190 Downregulation of the CaSR gene by hypermethylation is associated with neuroblastomas.
23103379 CaSR is functionally expressed in the T cells, the activated CaSR contributes to the cytokine secretion through the partial MAPK and NF-kappaB pathways.
23009664 A D410E mutation is a novel activating mutation in the ECD loop 3 of CASR in a family with autosomal dominant hypocalcemia.
22798347 Data indicate that mutations in the HHD and ECL of the CaSR induce pathway-selective bias that favors the preferential activation (gain of function) or inhibition (loss of function) of one signaling pathway over another.
22789683 Two CASR gene-activating mutations have been identified in two families with autosomal dominant hypocalcemia.
22730443 The extracellular calcium-induced increase in cytosolic Ca(2+) due to upregulated CaSR, contributes to the augmented Ca(2+) influx and excessive pulmonary artery smooth muscle cell proliferation in pulmonary arterial hypertension.
22577108 The efficacy profile of cinacalcet in patients with MEN1-related hyperparathyroidism and in those with sPHPT was similar and was not influenced by the 990 CASR variant.
22449852 These findings support the relevance of the CaSR in the pathophysiology of obesity-induced adipose tissue dysfunction.
22424352 A higher incidence of R990G and Q1011E polymorphisms in the calcium sensing receptor was found in Hirschsprung's disease patients compared to controls.
22422767 Studies of disease-associated calcium-sensing receptor (CaSR) mutations elucidated the role of the extracellular bilobed venus flytrap domain (VFTD) cleft region in Ca(2+) binding and the function of CaSR.
22403735 CaR-AQP2 interplay represents an internal renal defense to mitigate the effects of hypercalciuria on the risk of calcium precipitation during antidiuresis
22315359 patient had a novel germline heterozygous CASR mutation (c.361_364GATT; p.D121del/fsX122); biochemical phenotype of all family members carrying the heterozygous deletion was concordant with classic familial hypocalciuric hypercalcemia syndrome
22278364 Polymorphisms in CASR is not associated with colorectal cancer.
22210744 Positive and negative allosteric modulators promote biased signaling at the calcium-sensing receptor
22192860 This study demonstrates the utility of HRM as a pre-screening method, adds 24 novel rare CASR variants, and further emphasizes the importance of clinical decision making based on all available information rather than bioinformatics alone.
22187299 germ-line inactivating mutations in CASR gene are common in young patients with clinically non-familial primary hyperparathyroidism
22158862 a novel large PEST-like sequence that participates in the sorting of internalized hCaR routed to the lysosomal/degradation pathway that regulates cell surface receptor numbers.
22144504 These results show a possible association between variation in CASR and odds of colorectal neoplasia as well as the potential role of variation in GC with circulating 25(OH)D concentrations.
22107799 CaSR is one of the candidate genes explaining individual predisposition to calcium nephrolithiasis.
22094462 CaSR control colonic epithelial cell proliferation in vivo and suggest that the mechanism involves regulation of beta-catenin phosphorylation.
22024717 our meta-analysis indicates that the CaSR A986S polymorphism might be associated with total and ionized calcium concentrations in healthy individuals.
22010828 14-3-3 proteins mediate CaR-dependent Rho signalling and may modulate the plasma membrane expression of the CaR.
21966463 results indicated no significant association between the CASR polymorphism (rs17251221) and the susceptibility of calcium nephrolithiasis; however, significant association between rs17251221 and stone multiplicity was found
21965686 analysis of CaV2.1 channel regulation by calcium-binding protein-1
21843504 These results suggest an interplay between the CaR and testin in the regulation of CaR-mediated Rho signalling with possible effects on the cytoskeleton.
21667241 A novel CASR mutation in a Tunisian familial hypocalciuric hypercalcemia/neonatal severe hyperparathyroidism family associated with mental retardation
21645025 Activating mutations in the calcium-sensing receptor: genetic and clinical spectrum in 25 patients with autosomal dominant hypocalcaemia .
21566074 study reported 2 novel heterozygous mutations of the CASR gene, an inactivating mutation in exon 4 and the first activating mutation reported to date in exon 6
21532883 CaR regulates parathyroid hormone-related protein gene expression and secretion in vitro and CaR was required for the rapid development of humoral hypercalcemia of malignancy
21521328 The coexistence of primary hyperparathyroidism and familial hypocalciuric hypercalcaemia in some patients suggests a pathogenetic role of CaSR mutations in primary hyperparathyroidism.
21441391 novel mutations in the calcium-sensing receptor gene in cases of autosomal dominant hypocalcaemia with hypercalciuria
21414629 The addition of 1,25(OH)(2)D and calcium-sensing receptor mutation analysis to a panel of investigations may improve diagnostic yield.
21393549 our results demonstrate the expression of functional CaSR in testicular tissue and sperm, which can be activated by calcimimetic AMG 641
21369680 Letter/Case Report: Familial hypocalciuric hypercalcemia patient with sarcoidosis and CaSR mutation.
21340433 CaR and Cav-1 co-localize on the plasma membrane in HUVECs and CaR-induced Ca(2+) influx is down-regulated by binding with Cav-1.
21317879 The results suggest that epigenetic inactivation of CASR has an important role in colorectal carcinogenesis.
21240254 Downregulation of CASR expression and global loss of parafibromin staining are strong negative determinants of prognosis in parathyroid carcinoma.
21209619 These results indicate that Rho is a downstream mediator of CaR in the regulation of Ca(2+)(o)-induced E-cadherin-mediated cell-cell adhesion and keratinocyte differentiation.
21187282 gamma-glutamyl peptides and L-amino acids activate the CaR via a common mechanism.
21183554 Polymorphisms located in the regulatory region of the CASR gene may increase susceptibility of the primary hyperparathyroidism patients to kidney stone production.
21130730 These findings suggest that CaSR plays an antilipolytic role by mediating potential [Ca(2+)](i) and cAMP pathways and resultant downregulation of lipolysis key enzymes in adipocytes.
21084311 CaR decreases cell surface expression of Kir4.1 channels via a mechanism that involves Galpha(q) and caveolin.
21082232 Observational study of gene-disease association. (HuGE Navigator)
21048031 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20846291 A CaSR missense mutation causing a loss-of-receptor-function can cause symptomatic primary hyperparathyroidism in adulthood.
20826781 Data show that a Ca(2+)-dependent, stoichiometric interaction between CaM and a CaM-binding domain (CaMBD) located within the C terminus of CaSR (residues 871-898).
20798521 Calcium sensing receptorin regulated by phosphorylation state of S899 in the recognition of the arginine-rich region.
20705733 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20697181 heterozygous mutation (D190G) identified in this study showed that reduction of activity of CASR to extracellular Ca(2+) caused familial hypocalciuric hypercalcemia in patients. study demonstrated importance of Asp-190 in response to Ca(2+) in CASR.
20668040 Calcilytics might offer medical treatment for patients with autosomal dominant hypocalcemia caused by calcilytic-sensitive CaSR mutants.
20661308 Observational study, meta-analysis, and genome-wide association study of gene-disease association. (HuGE Navigator)
20654748 Observational study of gene-disease association. (HuGE Navigator)
20648625 Results indicate that the extracellular calcium sensing receptor can function in two signaling modes in human colonic epithelial cells offering a potential link between gastrointestinal responses and food/nutrients uptake and metabolism.
20634891 Observational study of gene-disease association. (HuGE Navigator)
20631026 Loss-of-function mutant indicates that the ECD loop III is required for CaSR activity.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20602573 986S, 990G and E1011 alleles were associated with a recurrent kidney calcium-forming state
20602573 Observational study of gene-disease association. (HuGE Navigator)
20595056 Cells exposed to conditioned medium from subjects of higher BMI underwent a greater increase in CaSR protein, likely resulting from the greater proinflammatory cytokines secreted from obese tissue.
20558539 Observational study, meta-analysis, and genome-wide association study of gene-disease association. (HuGE Navigator)
20558521 Genetic variation increases risk for colorectal cancer among people with at least one A allele.
20558521 Observational study of gene-disease association. (HuGE Navigator)
20457124 the intracellular trafficking of hCaR from the endoplasmic reticulum is Sar1-dependent via coat protein complex-II vesicles.
20424473 Observational study of gene-disease association. (HuGE Navigator)
20421307 Results suggest that CaSR is subject to cotranslational quality control.
20364112 None of the CaSR single nucleotide polymorphism genotypes were associated with prostate cancer risk overall. However, there was significant heterogeneity by stage of disease for the Q1011E polymorphism (p = 0.02).
20364112 Observational study of gene-disease association. (HuGE Navigator)
20361938 These results suggest that p24A is the limiting factor in CaSR trafficking in the early secretory pathway, and that cycling between the ER and ERGIC protects CaSR from degradation.
20237496 Observational study of gene-disease association. (HuGE Navigator)
20164288 CASR testing, with functional analysis, provides critical confirmatory evidence in the differential diagnosis of hypercalcemic states
20164288 Observational study of gene-disease association. (HuGE Navigator)
20130845 We show the importance of the 826 residue in the CaR response to calcium and calcimimetics. Since this change was described as a natural variant, the differences in the calcium and calcimimetic responses between the alleles has clinical relevance.
20067903 Single-nucleotide polymorphisms and CATTCA haplotype of the CaSR gene first block is associated with kidney stones in normocitraturic patients.
20067903 Observational study of gene-disease association. (HuGE Navigator)
20034274 In three Scottish kindreds we have identified two new mutations in the calcium sensing receptor (CASR).
19915295 in PTH-deficient idiopathic hypocalcemia, we found two novel missense mutations in the calcium-sensing receptor
19913121 Observational study of gene-disease association. (HuGE Navigator)
19912241 Observational study of gene-disease association. (HuGE Navigator)
19887834 Observational study of gene-disease association. (HuGE Navigator)
19839774 CaSR polymorphisms cannot be predictors of secondary hyperparathyroidism in kidney transplantation.
19839774 Observational study of gene-disease association. (HuGE Navigator)
19789209 Novel loss-of-function Q459R mutation in the CASR gene that exhibits mildly reduced sensitivity to calcium and that is associated with apparent autosomal recessive transmission of familial hypocalciuric hypercalcemia.
19716891 Enhancement of choline kinase activation and phosphocholine production in breast cancer cells occurs via a CaR-Galpha12-Rho signaling pathway.
19706842 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19695239 Observational study of gene-disease association. (HuGE Navigator)
19692168 Observational study of gene-disease association. (HuGE Navigator)
19690432 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
19640368 co-presence of CaSR gene AA990 and CC1011 alleles is a possible risk factor for bad prognosis in secondary hyperparathyroidism.
19640368 Observational study of gene-disease association. (HuGE Navigator)
19625176 Observational study of gene-disease association. (HuGE Navigator)
19621386 The known tumor-suppressive function of vitamin D requires functional CaSR. Ectopic expression of wild-type CaSR in colon carcinoma cells also inhibited the expression of TS and survivin and enhanced cellular sensitivity to 5-FU.
19580466 The aim of this study was to define the binding domains on the CaSR of anti-CaSR antibodies found in autoimmune polyglandular syndrome type 1 patients.
19474519 Observational study of gene-disease association. (HuGE Navigator)
19471101 The calcium-sensing receptor activates Mitogen-Activated Protein Kinase 3 via a Type C Phospholipases-dependent pathway.
19453261 Observational study of gene-disease association. (HuGE Navigator)
19432691 The results of this study are not enough to prove the role of CaSR gene polymorphisms in the development of valvular calcification in renal patients
19432691 Observational study of gene-disease association. (HuGE Navigator)
19423559 causal link between CASR mutation and parathyroid adenoma may be present in a familial hypocalciuric hypercalcemia affected family
19397786 The expression of the calcium receptor is sufficient to confer the regulation of parathyroid hormone gene expression to these heterologous cells
19389809 The established approaches can be used with current and newly identified CaSR mutations to identify the location of biosynthetic block and to determine the likelihood of rescue by allosteric agonists.
19350667 CaR and PTHrP were expressed in differentiated, favorable neuroblastic tumors, and both genes were up-regulated by inducing differentiation.
19328421 Antibodies that are directed against the parathyroid cell surface calcium-sensing receptor (CaSR) have recently been recognized to be present in the serum of patients with autoimmune hypoparathyroidism
19285978 the activation of the CaSR by elevated Ca2+(o) concentrations, such as those found near resorbing bone, produces an especially strong chemoattractant effect on bone metastatic breast cancer cells toward the Ca2+-rich environment
19257819 one function of Gcm2 is to maintain high levels of CaR expression in parathyroid cells.
19237714 Review of the role of the CaR in various benign and malignant tumors in further detail, describing its contribution to parathyroid tumors, breast, prostate, and colon cancers.
19179454 Eight novel and five recurrent familial hypocalciuric hypercalcemia mutations, along with six novel and two recurrent autosomal dominant hypocalcemia CASR mutations, are reported.
19179454 Observational study of genetic testing. (HuGE Navigator)
19170196 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19157541 Activation of the CaR stimulates TRPV5-mediated Ca(2+) influx via a PMA-insensitive PKC isoform pathway.
19133942 A 2-site model for renal stone formation using CASR loci SNPS, R990G and A986S showed that the single-locus model for the R990G increases the risk 8 fold & addition of the A986S genotype provides no additional information.
19133942 Observational study of gene-disease association. (HuGE Navigator)
19088423 Stimulation of CaSR leads to activation of MEK1/ERK1,2 and PLC pathways and up-regulation of cell proliferation.
19073830 Four unreported heterozygous CASR mutations were identified, including three missense (H595Y, P748H, and C765W) and one splice site (IVS2+1G>C) mutation
19066294 in African-Americans, functional heterogeneity of the CASR in thick ascending limb may influence BP.
19066294 Observational study of gene-disease association. (HuGE Navigator)
19058262 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19038444 Extracellular Ca(2+) and CaSR may constitute a robust ligand-receptor system in regulating the biologic phenotype of breast epithelial cells and loss of CaSR expression may promote malignancy and resistance to cytotoxic drugs.
19035514 CASR has a role in Alzheimer disease susceptibility.
19011996 Mechanisms of CaR-induced cancer cell growth and survival.
18980667 LCT 13910 C/T and CaSR A986S polymorphisms may have an impact on the progression and/or incidence of ColoRectal Cancer.
18980667 Observational study of gene-disease association. (HuGE Navigator)
18938753 Our study suggests, for the first time, that CASR mutation may be a risk for TCP, and that this risk may be further increased if there is an associated SPINK1 mutation.
18852253 Calcification is associated with loss of functional calcium-sensing receptor in vascular smooth muscle cells.
18843020 A statistically significant association between CASR variants and proximal colon cancer risk but not distal colon cancer risk was observed.
18843020 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
18796518 functional characterization of seven novel mutations of the CaSR found in familial hypocalciuric hypercalcemia patients
18756473 Identification of novel, missense CASR variants at evolutionarily-conserved residues in epilepsy patients and CASR expression in various subregions of human brain raises the possibility of involvement of CASR in pathophysiology of epileptic disorders.
18751724 Neonatal severe primary hyperparathyroidism was du to heterozygous inactivating mutation in the CASR gene.
18712808 the transactivation of the CASR promoter-reporter constructs by wild-type Glial cells missing-2 is completely abolished in the presence of the dominant-negative mutant Glial cells missing-2.
18703641 Activation of CaSR stimulates secretion of Wnt5a from myofibroblasts. Stimulation of epithelia by CaSR increased expression of receptor for Wnt5a, Ror2, suggesting existence of unique paracrine relationship for CDX2 homoeostasis in intestine.
18680227 The risk of chronic pancreatitis with CASR R990G is increased in subjects with moderate to heavy alcohol consumption.
18680227 Observational study of gene-disease association. (HuGE Navigator)
18676680 Observational study of gene-disease association. (HuGE Navigator)
18622738 the role of the CaSR modulating basal lipolysis elicits great interest, given its metabolic sensing capabilities due to the variety of ligands that regulate its activity, and its potential cross-talk with insulin and adipose tissue-secreted factors.
18621740 Because PTHrP contributes to hypercalcemia and bone metastases, switching of G-protein usage by the CaR may contribute to the pathogenesis of breast cancer.
18525093 Direct DNA sequencing of the CASR gene in a patient with asymtomatic hypercalcemia heterozygous for c.2501delC, a novel frame shift mutation predicted to cause loss of function of the CASR gene.
18497443 CaR mediates a variety of functions of Ca2+ o in the bone microenvironment under both normal and pathological conditions
18443236 Observational study of gene-disease association. (HuGE Navigator)
18410554 A two-step diagnostic procedure, where the first step is based on the calcium/creatinine clearance ratio, and the second step is CASR gene analysis in patients with familial hypocalciuric hypercalcemia or primary hyperparathyroidism.
18393231 Adolescent girls carrying the G allele of IL-6 gene at -634C/G and S allele of CASR gene at A986S could potentially be the risk population of lower bone mass accrual.
18393231 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18348986 Stat1/3 directly controls promoter P1 of the CASR, and the Stats indirectly regulate promoter P2 of the CASR via Sp1/3 in response to IL-6
18328986 The CaSR is a membrane-bound 7TM receptor expressed in several tissues such as the parathyroid gland, kidney, gut and bone, and regulates Ca2+ homeostasis by acting as the body's "calciostat".
18322048 A correlation was found between vitamin D receptor and calcium-sensing receptor activation therapy and parathyroid hyperplasia.
18296474 heterozygote for a missense mutation c.623G>C in exon 4 CASR gene very likely causes hypercalciuric hypercalcemia in this familial disorder. The mutation has not been described previously.
18065418 the CaR regulates cell survival and Ca(2+)(o)-induced differentiation in keratinocytes at least in part by activating the E-cadherin/PI3K pathway through a Src family tyrosine kinase-mediated signaling
17974568 Direct CaSR involvement was demonstrated by using an si-RNA of CaSR that impeded [Ca(2+)](e)-mediated induction of vitamin D receptor.
17962359 CaSR is present on basal cells of the human esophagus and is present in a functional manner on the esophageal epithelial cell line, HET-1A.
17932932 A three-dimensional model of the human Calcium-sensing receptor (CaSR) seven transmembrane domain was built via a novel sequence alignment method based on the conserved contacts in proteins using the crystal structure of bovine rhodopsin as the template
17853337 Pancreatitis in primary hyperparathyroidism is not associated with mutations in the CASR gene but may be related to polymorphisms.
17698911 Observational study of gene-disease association. (HuGE Navigator)
17698911 familial hypocalciuric hypercalcemia is caused by inactivating mutations in the calcium sensing receptor
17623778 data suggest cells ruffle upon CaSR (calcium sensing receptor)stimulation via a mechanism that involves translocation of beta-arrestin 1 pre-assembled with the CaSR or ARNO (Arf nucleotide binding site opener)
17591780 CaRs and GABA-B-R subunits can form heteromeric complexes in cells, and their interactions affect cell surface expression and signaling of CaR, which may contribute to extracellular Ca(2+)-dependent receptor activation in target tissues
17555508 We present the fourth neonatal severe hyperparathyroidism case induced by a novel de novo heterozygous inactivating mutation (R551K) of the CaSR gene.
17537980 data demonstrate the presence of a functional CaSR in human artery and show a correlation between CaSR expression and progression of chronic kidney disease
17513419 Aromaatic amino acids have a physiological impact on systems in which the CaR is expressed.
17482347 cyclin D1 expression in human tumoral parathyroid cells is regulated by calcium sensing receptor activation
17478419 identification of three potential Ca(2+)-binding sites in a modeled CaSR structure using computational algorithms
17473068 identification of a novel CASR gene mutation established the basis of the hypercalcemia in an individual with familial hypocalciuric hypercalcemia (FHH) and his family; concomitant vitamin D deficiency modulates the severity of the presentation of FHH
17463182 Our findings demonstrate that APC status plays a key role as a determinant of Wnt5a secretion and suggest that CaSR-mediated secretion of Wnt5a will inhibit defective Wnt signaling in APC-truncated cells in an autocrine manner.
17426287 Endocytosis and trafficking of CaR modulate PTHrP secretion.
17374709 CaSR is an autoantigen in autoimmune polyendocrine syndrome type I
17374704 Observational study of gene-disease association. (HuGE Navigator)
17374704 Serine at position 986 of CASR may be an independent genetic predictor of angiographic coronary artery disease, previous myocardial infarct, and cardiovascular mortality
17372216 the hypocalciuric hypercalcemia autoantibody induces allosteric transition among active human Ca-sensing receptor conformations
17332735 Observational study of gene-disease association. (HuGE Navigator)
17332735 R990G polymorphism of CASR does produce a gain-of-function and predispose to primary hypercalciuria.
17331389 Observational study of genotype prevalence and gene-disease association. (HuGE Navigator)
17320849 Observational study of genotype prevalence. (HuGE Navigator)
17320849 SNP frequency and haplotype structure of CASR; at least three haplotype blocks can be identified; the three exon 7 missense SNPs account for a significant portion of the total variation in that block
17310098 in the human gastric parietal cell the CaSR is coupled to pertussis toxin sensitive heterotrimeric G-Proteins and requires calcium to enhance the activity of the proton-pump.
17309124 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17309124 provides evidence of an interaction between a SNP of the CASR gene and birthweight in determination of bone mass in a UK female population
17284438 Disorders of calcium homeostasis caused by CaR mutations may result from altered receptor biogenesis independent of receptor function, i.e. a protein folding disorder.
17138967 Data suggest that the CaSR mediates the effective concentration of BMP-2 in the intestine, which leads to enhanced repair and barrier development.
17132283 A986S, Q1011E and R990G polymorphisms in West of Scotland population produced no statistical difference in serum total calcium or parameters of urine calcium excretion.
17124506 Our results indicate that calcium sensing receptor (CaR) regulates keratinocyte differentiation in part by modulating Ca2+(i) stores via interactions with Ca2+ pumps and channels that regulate those stores.
17122384 Calcium-sensing receptor interacts directly with Kir4.1 and Kir4.2 and can decrease their currents.
17110864 A cytosine-to-guanine mutation at 1772 caused a new serine-to-cysteine substitution of the calcium-sensing receptor gene, causing severe neonatal hyperparathyroidism, a variant of hypocalciuric hypercalcemia.
17097611 These results suggest that in bone fibroblasts elevated extracellular Ca(2+) may enhance COX-2 expression via the activation of ERK1/2, p38 MAPK, and JNK through CasR.
17062884 Observational study of gene-disease association. (HuGE Navigator)
17062884 patients with primary hyperparathyroidism, bearing the 990G allele, had lower serum PTH levels & higher urinary calcium excretion in comparison with the other genotype, suggesting an increased sensitivityof the variant receptor to extracellular calcium
17054460 results reveal that the three CaSR polymorphisms of the coding region (Ala986Ser, Arg990Gly and Gln1011Glu) have no major influence on indices of calcium homeostasis in this female population, and that they do not alter receptor function
17046587 Observational study of gene-disease association. (HuGE Navigator)
17018660 Observational study of gene-disease association. (HuGE Navigator)
16938272 biophysical analyis of CaSR with its enthalpy and entropy values
16854379 AMSH-1 has a negative effect on signaling of human calcium-sensing receptor.
16740430 Observational study of gene-disease association. (HuGE Navigator)
16738533 in hyperparathyroidism after renal allograft, VDR and CSR index in diffuse hyperplasia was higher than in uremic diffuse hyperplasia but lot in nodular hyperplasia
16735501 a missense mutation in the seven-transmembrane domain of the human Ca2+ receptor converts a negative allosteric modulator into a positive allosteric modulator
16642557 analysis of a mutation in the calcium-sensing receptor gene in familial benign hypocalciuric hypercalcemia
16622736 Observational study of gene-disease association. (HuGE Navigator)
16616098 The present study demonstrates for the first time the expression and localization of CaSR protein in human oocytes.
16598859 a novel heterozygous loss-of-function R465Q mutation of the CASR gene, which is characterized by a blunted response to calcium stimulation, thereby causing familial benign hypocalciuric hypercalcemia (FBHH).
16596260 Results showed significantly decreased mean expression of CaSR correlated with parathyroid histology.
16509534 Mutational analysis demonstrated a homozygous 5 base-pair deletion in the CaR gene located at the 5' end of exon 4 which would result in a severely truncated, non-functional receptor with only the first 164 amino acids of the CaR.
16497624 CASR gene is a novel yet undetected co-factor in a multifactorial genetic setting of SPINK1-related pancreatitis that alters the susceptibility for pancreatitis in these patients.
16472767 Expression of alternatively spliced variants of the calcium-sensing receptor (CaR) may result in the absence of a functional response to other known CaR agonists in human aortic endothelial cells
16278666 data indicate that calcium sensing receptor upregulation and MAP kinase signalling are both intermediates in the control of colon carcinoma cell growth and differentiation
16218047 Observational study of gene-disease association. (HuGE Navigator)
16218047 Serum FSH and LH levels are associated with intron 5 C/T (but not A986S) polymorphism of the CaR gene in untreated post-menopausal women
16147994 The amino acid structure of the binding pocket of CASR in its WT and mutant forms is reported.
16117875 Observational study of gene-disease association. (HuGE Navigator)
16109841 These experiments demonstrate the presence of a functional CaSR in the human stomach and show that this receptor may modulate the activity of acid-secreting H(+)-K(+)-ATPase in parietal cells.
15960151 In gain-of-function CaSR mutations, the genetic abnormalities increase CaSR activity leading to the development of such clinical manifestations as hypercalciuric hypocalcemia and hypoparathyroidism.
15888439 the T145A/S170T mutation of CaSR selectively disables l-amino acid sensing and the Ca2+ and l-amino acid-sensing functions of the CaR can be dissociated
15879434 Impaired cotranslational processing of the calcium-sensing receptor due to signal peptide missense mutations is associated with familial hypocalciuric hypercalcemia
15864123 the CaSR gene polymorphism Arg990Gly may have an effect on response to cinacalcet in patients with end-stage renal failure
15837785 G12, Rho, filamin-A, and the actin cytoskeleton are required for amino acid-stimulated Ca2+ oscillations produced by the Ca2+-sensing receptor
15805541 CaR stimulates apoptosis via a pathway involving GTP binding protein alpha subunit (Galpha(i))-dependent ceramide accumulation, activation of stress-activated protein kinase/c-Jun N-terminal kinase, c-Jun phosphorylation & caspase-3, & DNA cleavage.
15781005 Observational study of gene-disease association. (HuGE Navigator)
15718278 first report of calcium-sensing receptor (CaSR) being expressed in human adipocytes and adipocyte progenitor cells
15684428 Data show that the calcium-sensing receptor (CASR) gene has several functional kappaB elements that mediate its upregulation by proinflammatory cytokines.
15657061 Interaction with filamin A increases cellular CaR by preventing CaR degradation, thereby facilitating CaR signaling.
15637145 CASR responsiveness in parathyroid glands is regulated by G protein receptor kinases and beta-arrestins.
15613438 Because the activation of CaSR by oral calcium and peptones directly induces gastrin release, the higher gastrin responses to these stimuli suggest an increased sensitivity of gastrin-secreting cells CaSR in patients with hypercalciuria
15598778 Observational study of gene-disease association. (HuGE Navigator)
15591042 a seven-transmembrane domain region of the human Ca2+ receptor is critical for response to Ca2+
15579475 the Venus Fly Trap (VFT) domain of CaR, but none of its other major domains, is required for amino acid sensing
15572418 Direct sequence analysis of exon 4 of her CASR gene identified a heterozygous R227Q mutation in the extracellular domain of the receptor in familial (benign) hypocalciuric hypercalcemia or neonatal yperparathyroidism.
15531522 Observational study of gene-disease association. (HuGE Navigator)
15501733 Observational study of gene-disease association. (HuGE Navigator)
15472173 Observational study of gene-disease association. (HuGE Navigator)
15219850 Proximal and distal signal transduction cascades activated by the calcium sensing receptor may reflect transactivation of the epidermal growth factor receptor by the extracellular calcium-sensing receptor
15201280 CaR mutations show reduced pH(o) modulation, suggesting a molecular mechanism for increased calcium-sensing receptor activity at physiological pH(o)
14985373 Observational study of gene-disease association. (HuGE Navigator)
14985373 genotype phenotype analysis in familial isolated hyperparathyroidism
14976203 transmembrane segments and amino acid residues involved in the recognition of calcimimetics and calcilytics are delineated
14729680 CaR dimerization through its ECD is essential for the formation of a functional tertiary structure of the CaR.
14713274 patients studied had serological evidence of organ-specific autoimmunity against the CaSR protein in hypoparathyroidism
14660633 model of the transmembrane domain of the human calcium sensing receptor and localization of an allosteric binding site
14508624 Observational study of gene-disease association. (HuGE Navigator)
14508624 Casr polymorphism does not predict serum calcium level, bone density, calcaneal ultrasound indices, or fracture rate in a large cohort of elderly women.
12914574 Observational study of genotype prevalence. (HuGE Navigator)
12899245 Neoplastic colon epithelial cells can respond to antimitogenic signals generated by activation of the CaR as long as they express sufficient amounts of the CaR protein.
12890593 new insights into the mechanism of receptor activation and into the mechanism of action of allosteric modulators of the receptor [review]
12783889 localization of m-calpain within caveolae may contribute to maintenance of the enzyme in an inactive state and that m-calpain may also contribute to the regulation of calcium-sensing receptor levels.
12773131 Observational study of gene-disease association. (HuGE Navigator)
12773131 Our data do not support a role of A986S CaR polymorphism in BMD and in the prevalence of fragility fractures in Italian postmenopausal women.
12700051 The calcium-sensing receptor is widely expressed in various tissues and likely serves important cellular functions beyond that of maintaining systemic calcium homeostasis, as evidenced in this review.
12656660 marked decreases in vitamin D receptor and calcium-sensing receptor expression could be responsible for the high proliferation of parathyroid cells and the pathological progression of hyperparathyroidism
12605346 protein kinase a and protein kinase c synergize in inhibiting Ca 2+o -stimulated inositol-1,4,5-trisphosphate signaling in calcium-sensing receptor-transfected HEK293 cells
12574201 Clinical trial of gene-environment interaction. (HuGE Navigator)
12544508 Observational study of gene-environment interaction. (HuGE Navigator)
12517779 functions in human colon carcinomas: promotes E-cadherin expression and suppresses beta-catenin/TCF activation
12469911 role of R648 stop mutation in familial hypocalciuric hypercalcemia
12459170 Data first document the fact that the myeloma cell lines, U266, IM-9, and RPMI8226, all express the calcium-sensing receptor (CaR) protein and mRNA.
12409307 Protein kinase C phosphorylation of the CaR prevents G protein subtypes from interacting with the region of the receptor critical for releasing Ca(2+) stores
12399473 The amino acid residues critical to both functions of CaR may contribute to interactions with either G proteins or between CaR monomers within the functional dimer
12239240 Observational study of gene-disease association. (HuGE Navigator)
12239240 Influence of calcium-sensing receptor gene on urinary calcium excretion in stone-forming patients.
12150336 Observational study of gene-disease association. (HuGE Navigator)
12095982 Three adjacent serines in the extracellular domains of the CaR are required for L-amino acid-mediated potentiation of receptor function.
12052452 Observational study of gene-disease association. (HuGE Navigator)
12050233 A family of autosomal dominant hypocalcemia with a positive correlation between serum calcium and magnesium: a novel gain of function mutation (Ser(820)Phe) in the calcium-sensing receptor.
12040821 Observational study of genotype prevalence and gene-disease association. (HuGE Navigator)
12036954 role of functional VDREs in CASR gene in mechanism whereby 1,25(OH)2D up-regulates parathyroid, thyroid C-cell, and kidney CASR expression
12018449 Observational study of gene-disease association. (HuGE Navigator)
11984699 Observational study of gene-disease association. (HuGE Navigator)
11979955 maintains Ca homeostasis
11907035 role in parallel activation of phosphatidylinositol 4-kinase and phospholipase C
11889203 alter the function of the CASR in several different ways.
11889154 examinations confirmed the diagnosis of familial hypocalciuric hypercalcemia as a result of C562Y calcium-sensing receptor mutation
11863123 Observational study of gene-disease association. (HuGE Navigator)
11863123 gene polymorphism affects the arathyroid response to moderate hypercalcemic suppression in end-stage renal disease
11762699 A heterozygous missense mutation in exon 6 that substitutes a glutamic acid for the glycine at codon 557 (Gly557Glu), which corresponds to the extracellular domain cosegregates with hypocalciuric hypercalcemia
11668634 acceptor splice site mutation in familial hypocalciuric hypercalcemia and neonatal severe hyperparathyroidism
11589681 Observational study of gene-disease association. (HuGE Navigator)
11248745 Observational study of gene-disease association. (HuGE Navigator)
11161843 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MAFYSCCWVLLALTWHTSAYGPDQRAQKKGDIILGGLFPIHFGVAAKDQDLKSRPESVECIRYNFRGFRW      1 - 70
LQAMIFAIEEINSSPALLPNLTLGYRIFDTCNTVSKALEATLSFVAQNKIDSLNLDEFCNCSEHIPSTIA     71 - 140
VVGATGSGVSTAVANLLGLFYIPQVSYASSSRLLSNKNQFKSFLRTIPNDEHQATAMADIIEYFRWNWVG    141 - 210
TIAADDDYGRPGIEKFREEAEERDICIDFSELISQYSDEEEIQHVVEVIQNSTAKVIVVFSSGPDLEPLI    211 - 280
KEIVRRNITGKIWLASEAWASSSLIAMPQYFHVVGGTIGFALKAGQIPGFREFLKKVHPRKSVHNGFAKE    281 - 350
FWEETFNCHLQEGAKGPLPVDTFLRGHEESGDRFSNSSTAFRPLCTGDENISSVETPYIDYTHLRISYNV    351 - 420
YLAVYSIAHALQDIYTCLPGRGLFTNGSCADIKKVEAWQVLKHLRHLNFTNNMGEQVTFDECGDLVGNYS    421 - 490
IINWHLSPEDGSIVFKEVGYYNVYAKKGERLFINEEKILWSGFSREVPFSNCSRDCLAGTRKGIIEGEPT    491 - 560
CCFECVECPDGEYSDETDASACNKCPDDFWSNENHTSCIAKEIEFLSWTEPFGIALTLFAVLGIFLTAFV    561 - 630
LGVFIKFRNTPIVKATNRELSYLLLFSLLCCFSSSLFFIGEPQDWTCRLRQPAFGISFVLCISCILVKTN    631 - 700
RVLLVFEAKIPTSFHRKWWGLNLQFLLVFLCTFMQIVICVIWLYTAPPSSYRNQELEDEIIFITCHEGSL    701 - 770
MALGFLIGYTCLLAAICFFFAFKSRKLPENFNEAKFITFSMLIFFIVWISFIPAYASTYGKFVSAVEVIA    771 - 840
ILAASFGLLACIFFNKIYIILFKPSRNTIEEVRCSTAAHAFKVAARATLRRSNVSRKRSSSLGGSTGSTP    841 - 910
SSSISSKSNSEDPFPQPERQKQQQPLALTQQEQQQQPLTLPQQQRSQQQPRCKQKVIFGSGTVTFSLSFD    911 - 980
EPQKNAMAHRNSTHQNSLEAQKSSDTLTRHQPLLPLQCGETDLDLTVQETGLQGPVGGDQRPEVEDPEEL    981 - 1050
SPALVVSSSQSFVISGGGSTVTENVVNS                                             1051 - 1078
//

Text Mined References (386)

PMID Year Title
27050483 2016 Calcium-sensing receptors signal constitutive macropinocytosis and facilitate the uptake of NOD2 ligands in macrophages.
26994139 2016 Allosteric Modulation of the Calcium-sensing Receptor Rectifies Signaling Abnormalities Associated with G-protein ?-11 Mutations Causing Hypercalcemic and Hypocalcemic Disorders.
26764418 2016 Novel calcium-sensing receptor cytoplasmic tail deletion mutation causing autosomal dominant hypocalcemia: molecular and clinical study.
26665756 [GENETIC RISK FACTORS FOR MULTIPLE KIDNEY STONE FORMATION IN THE RUSSIAN POPULATION].
26654249 2015 No association between the common calcium-sensing receptor polymorphism rs1801725 and irritable bowel syndrome.
26436544 2015 Arterial Expression of the Calcium-Sensing Receptor Is Maintained by Physiological Pulsation and Protects against Calcification.
26431875 2015 Intracellular Ca(2+) oscillations generated via the extracellular Ca(2+)-sensing receptor (CaSR) in response to extracellular Ca(2+) or L-phenylalanine: Impact of the highly conservative mutation Ser170Thr.
26317416 2015 14-3-3 Proteins Buffer Intracellular Calcium Sensing Receptors to Constrain Signaling.
26252839 2015 A genetic polymorphism (rs17251221) in the calcium-sensing receptor is associated with ovarian cancer susceptibility.
26166472 2015 Overrepresentation of Rare CASR Coding Variants in a Sample of Young French Patients With Idiopathic Chronic Pancreatitis.
26158657 A novel mutation of the calcium-sensing receptor gene in a Greek family from Nisyros.
26153034 2016 Significance of calcium-sensing receptor expression in gastric cancer.
26107257 2015 Polymorphisms in CaSR and CLDN14 Genes Associated with Increased Risk of Kidney Stone Disease in Patients from the Eastern Part of India.
25986659 2015 Preadipocyte proliferation is elevated by calcium sensing receptor activation.
25977473 2015 Negative feedback from CaSR signaling to aquaporin-2 sensitizes vasopressin to extracellular Ca2.
25972035 2015 Association of common variants in the calcium-sensing receptor gene with serum calcium levels in East Asians.
25910996 2015 The calcium-sensing receptor: And its involvement in parathyroid pathology.
25904744 2015 Calcium-sensing receptor antagonists abrogate airway hyperresponsiveness and inflammation in allergic asthma.
25786244 2015 Association studies of calcium-sensing receptor (CaSR) polymorphisms with serum concentrations of glucose and phosphate, and vascular calcification in renal transplant recipients.
25766501 2015 Novel activating mutation of human calcium-sensing receptor in a family with autosomal dominant hypocalcaemia.
25758239 2016 Active vitamin D potentiates the anti-neoplastic effects of calcium in the colon: A cross talk through the calcium-sensing receptor.
25705702 2015 The G allele of CaSR R990G polymorphism increases susceptibility to urolithiasis and hypercalciuria: evidences from a comprehensive meta-analysis.
25701780 2015 Computational analysis of the extracellular domain of the Ca²?-sensing receptor: an alternate model for the Ca²? sensing region.
25701758 2015 The calcium-sensing receptor: A promising target for prevention of colorectal cancer.
25695075 2015 R990G polymorphism of calcium sensing receptor gene is associated with high parathyroid hormone levels in subjects with vitamin D deficiency: a cross-sectional study.
25631355 2015 NKCC2 activity is inhibited by the Bartter's syndrome type 5 gain-of-function CaR-A843E mutant in renal cells.
25420019 2014 Role of Ca2+ and L-Phe in regulating functional cooperativity of disease-associated "toggle" calcium-sensing receptor mutations.
25401741 2014 The intron 4 polymorphism in the calcium-sensing receptor gene in diabetes mellitus and its chronic complications, diabetic nephropathy and non-diabetic renal disease.
25382680 2015 Transcription factor CREB is involved in CaSR-mediated cytoskeleton gene expression.
25365856 2014 A novel mutation in the calcium sensing receptor gene in a neonate with severe hyperparathyroidism. .
25331955 2014 Molecular mechanisms of calcium-sensing receptor-mediated calcium signaling in the modulation of epithelial ion transport and bicarbonate secretion.
25305020 2014 Direct determination of multiple ligand interactions with the extracellular domain of the calcium-sensing receptor.
25292184 2014 A novel mutation in calcium-sensing receptor gene associated to hypercalcemia and hypercalciuria.
25270285 2014 A genetic variant (rs17251221) in the calcium-sensing receptor relates to hepatocellular carcinoma susceptibility and clinical outcome treated by transcatheter hepatic arterial chemoembolization (TACE) therapy.
25134967 2014 Total calcium-sensing receptor expression in circulating monocytes is increased in rheumatoid arthritis patients with severe coronary artery calcification.
25104082 2014 Calcium-sensing-related gene mutations in hypercalcaemic hypocalciuric patients as differential diagnosis from primary hyperparathyroidism: detection of two novel inactivating mutations in an Italian population.
25091521 2015 Calcium-sensing receptor sequencing in 21 patients with idiopathic or familial parathyroid disorder: pitfalls and characterization of a novel I32 V loss-of-function mutation.
25080008 2014 Roles of intraloops-2 and -3 and the proximal C-terminus in signalling pathway selection from the human calcium-sensing receptor.
25069966 2014 Roles of the calcium sensing receptor in digestive physiology and pathophysiology (review).
25063217 2014 Involvement of calcium-sensing receptors in hypoxia-induced vascular remodeling and pulmonary hypertension by promoting phenotypic modulation of small pulmonary arteries.
25039540 2014 Activating calcium-sensing receptor gene variants in children: a case study of infant hypocalcaemia and literature review.
25019182 2014 Calcium-sensing receptor gene polymorphisms in patients with calcium urolithiasis: a systematic review.
24948534 2014 The A? peptides-activated calcium-sensing receptor stimulates the production and secretion of vascular endothelial growth factor-A by normoxic adult human cortical astrocytes.
24947037 2014 Cardiometabolic phenotyping of patients with familial hypocalcuric hypercalcemia.
24930987 2014 Calcium sensing receptor in pregnancies complicated by gestational diabetes mellitus.
24905090 2014 Calcium sensing receptor modulates extracellular calcium entry and proliferation via TRPC3/6 channels in cultured human mesangial cells.
24854525 2014 A novel CASR mutation associated with neonatal severe hyperparathyroidism transmitted as an autosomal recessive disorder.
24842051 2014 The roles of calcium-sensing receptor and calcium channel in osteogenic differentiation of undifferentiated periodontal ligament cells.
24832896 2015 Risk of nephrolithiasis in primary hyperparathyroidism is associated with two polymorphisms of the calcium-sensing receptor gene.
24770445 2014 Pathological function of Ca2+-sensing receptor in pulmonary arterial hypertension.
24691920 2014 Calcium-sensing receptor silencing in colorectal cancer is associated with promoter hypermethylation and loss of acetylation on histone 3.
24584713 2014 Prognostic significance of calcium-sensing receptor in breast cancer.
24559921 2014 The calcium-sensing receptor and ?-cell function.
24517148 2014 A homozygous CaSR mutation causing a FHH phenotype completely masked by vitamin D deficiency presenting as rickets.
24481145 2014 A genetic polymorphism (rs17251221) in the calcium-sensing receptor is associated with breast cancer susceptibility and prognosis.
24455835 2013 [Gene polymorphism of the vitamin D receptor, vitamin D-binding protein and calcium-sensing receptor in respect of calcium-phosphate disturbances in chronic dialysis patients].
24454825 2014 Role of receptor activity modifying protein 1 in function of the calcium sensing receptor in the human TT thyroid carcinoma cell line.
24336654 2014 Intracellular Ca2+ oscillations generated via the Ca2+-sensing receptor are mediated by negative feedback by PKC? at Thr888.
24297799 2014 Functional activities of mutant calcium-sensing receptors determine clinical presentations in patients with autosomal dominant hypocalcemia.
24264723 2014 The ZnR/GPR39 interacts with the CaSR to enhance signaling in prostate and salivary epithelia.
24244430 2013 Excessive signal transduction of gain-of-function variants of the calcium-sensing receptor (CaSR) are associated with increased ER to cytosol calcium gradient.
24238055 2013 Development of a calcium-sensing receptor molecular imaging agent.
24217682 2014 Calcimimetics increase CaSR expression and reduce mineralization in vascular smooth muscle cells: mechanisms of action.
24133354 2013 Genetic and clinical characteristics of korean patients with isolated hypoparathyroidism: from the Korean hypopara registry study.
24120622 2014 The calcium-sensing receptor R990G polymorphism is associated with increased risk of hypertriglyceridemia in obese Chinese.
24101400 2013 Altered monocyte calcium-sensing receptor expression in patients with type 2 diabetes mellitus and atherosclerosis.
24098349 2013 Determination and modulation of total and surface calcium-sensing receptor expression in monocytes in vivo and in vitro.
24068962 2013 Meta-analysis of genome-wide association studies identifies six new Loci for serum calcium concentrations.
24013548 2013 Activation of the Ca²+-sensing receptor induces deposition of tight junction components to the epithelial cell plasma membrane.
23946278 2013 Clinical phenotypes of Chinese primary hyperparathyroidism patients are associated with the calcium-sensing receptor gene R990G polymorphism.
23917029 2013 Calcium-sensing in the kidney.
23913941 2013 Methylation status of the CpG islands in vitamin D and calcium-sensing receptor gene promoters does not explain the reduced gene expressions in parathyroid adenomas.
23864702 2013 Decreased transcriptional activity of calcium-sensing receptor gene promoter 1 is associated with calcium nephrolithiasis.
23860708 2013 Serum calcium and the calcium-sensing receptor polymorphism rs17251221 in relation to coronary heart disease, type 2 diabetes, cancer and mortality: the Tromsø Study.
23856265 2013 Calcium-sensing receptor (CaSR) mutations and disorders of calcium, electrolyte and water metabolism.
23817301 2013 Neonatal hypercalcemia due to a homozygous mutation in the calcium-sensing receptor: failure of cinacalcet.
23764372 2013 Muscle function and quality of life are not impaired in familial hypocalciuric hypercalcemia: a cross-sectional study on physiological effects of inactivating variants in the calcium-sensing receptor gene (CASR).
23756480 2013 The quest for juvenile myoclonic epilepsy genes.
23740560 2013 Allosteric regulation of the calcium-sensing receptor in obese individuals.
23674327 2013 Induction of CaSR expression circumvents the molecular features of malignant CaSR null colon cancer cells.
23639611 Cellular responses to TGF? and TGF? receptor expression in human colonic epithelial cells require CaSR expression and function.
23569134 2013 Calcium-sensing receptor and apoptosis in parathyroid hyperplasia of patients with secondary hyperparathyroidism.
23555732 2013 Association between CASR polymorphisms, calcium intake, and colorectal cancer risk.
23552627 2013 Analysis of ?-klotho, fibroblast growth factor-, vitamin-D and calcium-sensing receptor in 70 patients with secondary hyperparathyroidism.
23533647 2013 Polymorphisms in the calcium-sensing receptor gene are associated with clinical outcome of neuroblastoma.
23372019 2013 Impact of clinically relevant mutations on the pharmacoregulation and signaling bias of the calcium-sensing receptor by positive and negative allosteric modulators.
23334987 2013 Involvement of ?-klotho, fibroblast growth factor-, vitamin-D- and calcium-sensing receptor in 53 patients with primary hyperparathyroidism.
23300272 2013 Dihydropyridine Ca(2+) channel blockers increase cytosolic [Ca(2+)] by activating Ca(2+)-sensing receptors in pulmonary arterial smooth muscle cells.
23287098 2013 The effects of extracellular calcium-sensing receptor ligands on the contractility of pregnant human myometrium in vitro.
23271661 2012 Extracellular Ca2+ is a danger signal activating the NLRP3 inflammasome through G protein-coupled calcium sensing receptors.
23269116 2013 Epithelial calcium-sensing receptor activation by eosinophil granule protein analog stimulates collagen matrix contraction.
23247143 2013 Association of genome-wide variation with highly sensitive cardiac troponin-T levels in European Americans and Blacks: a meta-analysis from atherosclerosis risk in communities and cardiovascular health studies.
23228129 2013 The calcium-sensing receptor as a regulator of cellular fate in normal and pathological conditions.
23169696 2013 Two novel mutations of the calcium-sensing receptor gene affecting the same amino acid position lead to opposite phenotypes and reveal the importance of p.N802 on receptor activity.
23125333 2013 Common genetic variation of the calcium-sensing receptor and lethal prostate cancer risk.
23108190 2013 The calcium-sensing receptor is silenced by genetic and epigenetic mechanisms in unfavorable neuroblastomas and its reactivation induces ERK1/2-dependent apoptosis.
23103379 2013 Expression of the calcium sensing receptor in human peripheral blood T lymphocyte and its contribution to cytokine secretion through MAPKs or NF-?B pathways.
23009664 2013 Identification and characterization of D410E, a novel mutation in the loop 3 domain of CASR, in autosomal dominant hypocalcemia and a therapeutic approach using a novel calcilytic, AXT914.
22798347 2012 Identification of molecular phenotypes and biased signaling induced by naturally occurring mutations of the human calcium-sensing receptor.
22789683 2012 CASR gene activating mutations in two families with autosomal dominant hypocalcemia.
22730443 2012 Enhanced Ca(2+)-sensing receptor function in idiopathic pulmonary arterial hypertension.
22577108 2012 MEN1-related hyperparathyroidism: response to cinacalcet and its relationship with the calcium-sensing receptor gene variant Arg990Gly.
22449852 2012 Calcium sensing receptor activation elevates proinflammatory factor expression in human adipose cells and adipose tissue.
22424352 2012 Is there a link between the calcium sensing receptor and Hirschsprung's disease? A mutational analysis.
22422767 2012 Identification of 70 calcium-sensing receptor mutations in hyper- and hypo-calcaemic patients: evidence for clustering of extracellular domain mutations at calcium-binding sites.
22403735 2012 Calcium-sensing receptor and aquaporin 2 interplay in hypercalciuria-associated renal concentrating defect in humans. An in vivo and in vitro study.
22315359 2012 A novel germline inactivating mutation in the CASR gene in an Italian kindred affected by familial hypocalciuric hypercalcemia.
22278364 2012 Prediagnostic 25-hydroxyvitamin D, VDR and CASR polymorphisms, and survival in patients with colorectal cancer in western European ppulations.
22210744 2012 Positive and negative allosteric modulators promote biased signaling at the calcium-sensing receptor.
22192860 2012 Identification of rare and frequent variants of the CASR gene by high-resolution melting.
22187299 2012 Frequent germ-line mutations of the MEN1, CASR, and HRPT2/CDC73 genes in young patients with clinically non-familial primary hyperparathyroidism.
22158862 2012 Large putative PEST-like sequence motif at the carboxyl tail of human calcium receptor directs lysosomal degradation and regulates cell surface receptor level.
22144504 2012 Polymorphic variation in the GC and CASR genes and associations with vitamin D metabolite concentration and metachronous colorectal neoplasia.
22107799 2011 Calcium-sensing receptor and calcium kidney stones.
22094462 2012 Negative cross-talk between calcium-sensing receptor and ?-catenin signaling systems in colonic epithelium.
22024717 2012 Effects of the calcium-sensing receptor A986S polymorphism on serum calcium and parathyroid hormone levels in healthy individuals: a meta-analysis.
22010828 2012 The adaptor protein 14-3-3 binds to the calcium-sensing receptor and attenuates receptor-mediated Rho kinase signalling.
21966463 2011 A genetic polymorphism (rs17251221) in the calcium-sensing receptor gene (CASR) is associated with stone multiplicity in calcium nephrolithiasis.
21965686 2011 Molecular determinants of CaV2.1 channel regulation by calcium-binding protein-1.
21843504 2011 Testin, a novel binding partner of the calcium-sensing receptor, enhances receptor-mediated Rho-kinase signalling.
21667241 2012 A novel CASR mutation in a Tunisian FHH/NSHPT family associated with a mental retardation.
21645025 2011 Activating mutations in the calcium-sensing receptor: genetic and clinical spectrum in 25 patients with autosomal dominant hypocalcaemia - a German survey.
21643651 2012 Familial hypocalciuric hypercalcemia: new mutation in the CASR gene converting valine 697 to methionine.
21566074 2011 Mutations of calcium-sensing receptor gene: two novel mutations and overview of impact on calcium homeostasis.
21532883 2011 The calcium-sensing receptor is necessary for the rapid development of hypercalcemia in human lung squamous cell carcinoma.
21521328 2011 Inactivating calcium-sensing receptor mutations in patients with primary hyperparathyroidism.
21441391 2011 Four cases of autosomal dominant hypocalcaemia with hypercalciuria including two with novel mutations in the calcium-sensing receptor gene.
21414629 2011 Mild infantile hypercalcemia: diagnostic tests and outcomes.
21393549 Localization, distribution, and function of the calcium-sensing receptor in sperm.
21369680 2011 Sarcoidosis, hypercalcemia and calcium-sensing receptor mutation: a case report.
21340433 2011 [Extracellular Ca(2+)-sensing receptor-induced extracellular Ca2+ influx is down-regulated by caveolin-1 in human umbilical vein endothelial cells].
21317879 2011 Epigenetic inactivation of calcium-sensing receptor in colorectal carcinogenesis.
21240254 2011 Downregulation of CASR expression and global loss of parafibromin staining are strong negative determinants of prognosis in parathyroid carcinoma.
21209619 2011 The calcium-sensing receptor-dependent regulation of cell-cell adhesion and keratinocyte differentiation requires Rho and filamin A.
21187282 2011 Allosteric modulation of the calcium-sensing receptor by gamma-glutamyl peptides: inhibition of PTH secretion, suppression of intracellular cAMP levels, and a common mechanism of action with L-amino acids.
21183554 2011 Polymorphisms at the regulatory regions of the CASR gene influence stone risk in primary hyperparathyroidism.
21130730 2011 Involvement of calcium-sensing receptor in inhibition of lipolysis through intracellular cAMP and calcium pathways in human adipocytes.
21084311 2011 Calcium-sensing receptor decreases cell surface expression of the inwardly rectifying K+ channel Kir4.1.
21082232 2011 Influence of gene variants related to calcium homeostasis on biochemical parameters of women with polycystic ovary syndrome.
21048031 2011 Single nucleotide polymorphisms of matrix metalloproteinase 9 (MMP9) and tumor protein 73 (TP73) interact with Epstein-Barr virus in chronic lymphocytic leukemia: results from the European case-control study EpiLymph.
20861236 2010 Rab1 small GTP-binding protein regulates cell surface trafficking of the human calcium-sensing receptor.
20846291 2010 A homozygous inactivating calcium-sensing receptor mutation, Pro339Thr, is associated with isolated primary hyperparathyroidism: correlation between location of mutations and severity of hypercalcaemia.
20826781 2010 Calmodulin regulates Ca2+-sensing receptor-mediated Ca2+ signaling and its cell surface expression.
20798521 2010 Calcium sensing receptor mutations implicated in pancreatitis and idiopathic epilepsy syndrome disrupt an arginine-rich retention motif.
20705733 2010 Common variants in the calcium-sensing receptor gene are associated with total serum calcium levels.
20697181 2010 Identification and functional analysis of novel calcium-sensing receptor gene mutation in familial hypocalciuric hypercalcemia.
20668040 2010 Novel activating mutations of the calcium-sensing receptor: the calcilytic NPS-2143 mitigates excessive signal transduction of mutant receptors.
20661308 2010 Genome-wide meta-analysis for serum calcium identifies significantly associated SNPs near the calcium-sensing receptor (CASR) gene.
20654748 2010 High-density polymorphisms analysis of 23 candidate genes for association with bone mineral density.
20648625 2010 Extracellular calcium sensing receptor stimulation in human colonic epithelial cells induces intracellular calcium oscillations and proliferation inhibition.
20634891 2010 Maternal genes and facial clefts in offspring: a comprehensive search for genetic associations in two population-based cleft studies from Scandinavia.
20631026 2010 Naturally-occurring mutation in the calcium-sensing receptor reveals the significance of extracellular domain loop III region for class C G-protein-coupled receptor function.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20602573 2010 Association between calcium-sensing receptor gene polymorphisms and recurrent calcium kidney stone disease: a comprehensive gene analysis.
20595056 2010 Obesity-associated proinflammatory cytokines increase calcium sensing receptor (CaSR) protein expression in primary human adipocytes and LS14 human adipose cell line.
20558539 2010 Common genetic variants associate with serum phosphorus concentration.
20558521 2010 Genetic variation in the retinoid X receptor and calcium-sensing receptor and risk of colorectal cancer in the Colon Cancer Family Registry.
20457124 2010 Sar1-dependent trafficking of the human calcium receptor to the cell surface.
20424473 2010 L-type voltage-dependent calcium channel alpha subunit 1C is a novel candidate gene associated with secondary hyperparathyroidism: an application of haplotype-based analysis for multiple linked single nucleotide polymorphisms.
20421307 2010 Calcium-sensing receptor biosynthesis includes a cotranslational conformational checkpoint and endoplasmic reticulum retention.
20364112 2010 Prostate cancer in African-American men and polymorphism in the calcium-sensing receptor.
20361938 2010 The cargo receptor p24A facilitates calcium sensing receptor maturation and stabilization in the early secretory pathway.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
20164288 2010 Calcium-sensing receptor (CASR) mutations in hypercalcemic states: studies from a single endocrine clinic over three years.
20130845 2010 Residue 826 in the calcium-sensing receptor is implicated in the response to calcium and to R-568 calcimimetic compound.
20067903 2010 Calcium kidney stones are associated with a haplotype of the calcium-sensing receptor gene regulatory region.
20034274 2009 Two novel mutations causing familial benign hypocalciuric hypercalcaemia in three Scottish families.
19915295 2009 Novel gain of function mutations of the calcium-sensing receptor in two patients with PTH-deficient hypocalcemia.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19912241 2010 Multiplex ligation-dependent probe amplification (MLPA) screening for exon copy number variation in the calcium sensing receptor gene: no large rearrangements identified in patients with calcium metabolic disorders.
19887834 2010 Vitamin D receptor and calcium-sensing receptor gene polymorphisms in hypercalciuric stone-forming patients.
19839774 2010 Persistent secondary hyperparathyroidism and vertebral fractures in kidney transplantation: role of calcium-sensing receptor polymorphisms and vitamin D deficiency.
19789209 2009 A novel loss-of-function mutation, Gln459Arg, of the calcium-sensing receptor gene associated with apparent autosomal recessive inheritance of familial hypocalciuric hypercalcemia.
19716891 2009 Activation of choline kinase by extracellular Ca2+ is Ca(2+)-sensing receptor, Galpha12 and Rho-dependent in breast cancer cells.
19706842 2009 Vitamin D receptor and calcium sensing receptor polymorphisms and the risk of colorectal cancer in European populations.
19695239 2009 Genetic determinants of extracellular magnesium concentration: analysis of multiple candidate genes, and evidence for association with the estrogen receptor alpha (ESR1) locus.
19692168 2010 Genetic susceptibility to distinct bladder cancer subphenotypes.
19690432 2009 Associations of vitamin D receptor, calcium-sensing receptor and parathyroid hormone gene polymorphisms with calcium homeostasis and peripheral bone density in adult Finns.
19640368 2009 The clinical significance of parathyroid tissue calcium sensing receptor gene polymorphisms and expression levels in end-stage renal disease patients.
19625176 2009 PTEN identified as important risk factor of chronic obstructive pulmonary disease.
19621386 2010 Vitamin D mediates its action in human colon carcinoma cells in a calcium-sensing receptor-dependent manner: downregulates malignant cell behavior and the expression of thymidylate synthase and survivin and promotes cellular sensitivity to 5-FU.
19580466 2010 Mapping of human autoantibody binding sites on the calcium-sensing receptor.
19474519 2009 Mutation analysis of MEN1, HRPT2, CASR, CDKN1B, and AIP genes in primary hyperparathyroidism patients with features of genetic predisposition.
19471101 2009 Extracellular signal-regulated kinases 1 and 2 and TRPC1 channels are required for calcium-sensing receptor-stimulated MCF-7 breast cancer cell proliferation.
19453261 2009 High-density association study of 383 candidate genes for volumetric BMD at the femoral neck and lumbar spine among older men.
19432691 2009 Calcium-sensing receptor gene polymorphisms and cardiac valvular calcification in patients with chronic renal failure: a pilot study.
19423559 2009 Association of parathyroid adenoma and familial hypocalciuric hypercalcaemia in a teenager.
19397786 2009 The calcium-sensing receptor regulates parathyroid hormone gene expression in transfected HEK293 cells.
19389809 2009 Pharmacochaperone-mediated rescue of calcium-sensing receptor loss-of-function mutants.
19350667 2009 The calcium-sensing receptor and parathyroid hormone-related protein are expressed in differentiated, favorable neuroblastic tumors.
19328421 2009 Anti-parathyroid and anti-calcium sensing receptor antibodies in autoimmune hypoparathyroidism.
19285978 2009 Extracellular calcium promotes the migration of breast cancer cells through the activation of the calcium sensing receptor.
19257819 2009 Calcium-sensing receptor expression is regulated by glial cells missing-2 in human parathyroid cells.
19237714 2009 The role of the calcium-sensing receptor in the development and progression of cancer.
19179454 2009 Calcium-sensing receptor mutations and denaturing high performance liquid chromatography.
19170196 2009 Polymorphisms in innate immunity genes and lung cancer risk in Xuanwei, China.
19157541 2009 Activation of the Ca2+-sensing receptor stimulates the activity of the epithelial Ca2+ channel TRPV5.
19133942 2009 Heterogeneous disease modeling for Hardy-Weinberg disequilibrium in case-control studies: application to renal stones and calcium-sensing receptor polymorphisms.
19088423 2008 Extracellular calcium-sensing receptor mediated signalling is involved in human vascular smooth muscle cell proliferation and apoptosis.
19073830 2009 Identification and functional characterization of loss-of-function mutations of the calcium-sensing receptor in four Italian kindreds with familial hypocalciuric hypercalcemia.
19066294 2009 Association of the calcium-sensing receptor gene with blood pressure and urinary calcium in African-Americans.
19058262 2009 Allelic-based gene-gene interaction associated with quantitative traits.
19038444 2009 Calcium sensing receptor down-regulates malignant cell behavior and promotes chemosensitivity in human breast cancer cells.
19035514 2009 Evidence supporting a role for the calcium-sensing receptor in Alzheimer disease.
19011996 2009 Calcium-sensing receptor in cancer: good cop or bad cop?
18980667 2008 Effects of the lactase 13910 C/T and calcium-sensor receptor A986S G/T gene polymorphisms on the incidence and recurrence of colorectal cancer in Hungarian population.
18938753 2008 Novel mutations in the calcium sensing receptor gene in tropical chronic pancreatitis in India.
18852253 2009 Calcification is associated with loss of functional calcium-sensing receptor in vascular smooth muscle cells.
18843020 2008 Genetic variation in calcium-sensing receptor and risk for colon cancer.
18796518 2008 Novel inactivating mutations of the calcium-sensing receptor: the calcimimetic NPS R-568 improves signal transduction of mutant receptors.
18756473 2008 An idiopathic epilepsy syndrome linked to 3q13.3-q21 and missense mutations in the extracellular calcium sensing receptor gene.
18751724 2009 Unusually severe phenotype of neonatal primary hyperparathyroidism due to a heterozygous inactivating mutation in the CASR gene.
18712808 2009 Glial cells missing-2 (GCM2) transactivates the calcium-sensing receptor gene: effect of a dominant-negative GCM2 mutant associated with autosomal dominant hypoparathyroidism.
18703641 2008 CaSR stimulates secretion of Wnt5a from colonic myofibroblasts to stimulate CDX2 and sucrase-isomaltase using Ror2 on intestinal epithelia.
18680227 2008 Association between calcium sensing receptor gene polymorphisms and chronic pancreatitis in a US population: role of serine protease inhibitor Kazal 1type and alcohol.
18676680 2008 Pathway-based evaluation of 380 candidate genes and lung cancer susceptibility suggests the importance of the cell cycle pathway.
18622738 2008 Antilipolytic effect of calcium-sensing receptor in human adipocytes.
18621740 2008 Switching of G-protein usage by the calcium-sensing receptor reverses its effect on parathyroid hormone-related protein secretion in normal versus malignant breast cells.
18577758 2008 Dissociation of heterotrimeric g proteins in cells.
18525093 2008 A novel CASR gene mutation in an octogenarian with asymptomatic hypercalcaemia.
18497443 2008 Role of calcium-sensing receptor in bone biology.
18443236 2008 Common variants in genes underlying monogenic hypertension and hypotension and blood pressure in the general population.
18410554 2008 Discriminative power of three indices of renal calcium excretion for the distinction between familial hypocalciuric hypercalcaemia and primary hyperparathyroidism: a follow-up study on methods.
18393231 2008 [Effect of interleukin-6 and calcium sensing receptor gene polymorphisms on bone mass accrual in Chinese adolescent girls].
18348986 2008 The proinflammatory cytokine, interleukin-6, up-regulates calcium-sensing receptor gene transcription via Stat1/3 and Sp1/3.
18328986 2008 Hypercalcaemic and hypocalcaemic conditions due to calcium-sensing receptor mutations.
18322048 2008 Does vitamin D receptor and calcium receptor activation therapy play a role in the histopathologic alterations of parathyroid glands in refractory uremic hyperparathyroidism?
18296474 2008 A new missense mutation in the CASR gene in familial interstitial lung disease with hypocalciuric hypercalcemia and defective granulocyte function.
18240029 2008 Reviews in molecular biology and biotechnology: transmembrane signaling by G protein-coupled receptors.
18065418 2008 Inactivation of the calcium sensing receptor inhibits E-cadherin-mediated cell-cell adhesion and calcium-induced differentiation in human epidermal keratinocytes.
17979873 Structure and function of the human calcium-sensing receptor: insights from natural and engineered mutations and allosteric modulators.
17974568 2008 Extracellular calcium-sensing receptor activation induces vitamin D receptor levels in proximal kidney HK-2G cells by a mechanism that requires phosphorylation of p38alpha MAPK.
17962359 2008 The extracellular calcium-sensing receptor (CaSR) on human esophagus and evidence of expression of the CaSR on the esophageal epithelial cell line (HET-1A).
17932932 2008 Improved model building and assessment of the Calcium-sensing receptor transmembrane domain.
17853337 2007 Pancreatitis in primary hyperparathyroidism-related hypercalcaemia is not associated with mutations in the CASR gene.
17698911 2007 Molecular genetic analysis of the calcium sensing receptor gene in patients clinically suspected to have familial hypocalciuric hypercalcemia: phenotypic variation and mutation spectrum in a Danish population.
17623778 2007 The calcium-sensing receptor changes cell shape via a beta-arrestin-1 ARNO ARF6 ELMO protein network.
17591780 2007 Complex formation with the Type B gamma-aminobutyric acid receptor affects the expression and signal transduction of the extracellular calcium-sensing receptor. Studies with HEK-293 cells and neurons.
17555508 2007 Neonatal severe hyperparathyroidism associated with a novel de novo heterozygous R551K inactivating mutation and a heterozygous A986S polymorphism of the calcium-sensing receptor gene.
17537980 2007 Extracellular calcium-sensing receptor is functionally expressed in human artery.
17513419 2007 Aromatic L-amino acids activate the calcium-sensing receptor.
17482347 2007 Modulation of cyclin D1 expression in human tumoral parathyroid cells: effects of growth factors and calcium sensing receptor activation.
17478419 2007 Identification and dissection of Ca(2+)-binding sites in the extracellular domain of Ca(2+)-sensing receptor.
17473068 2007 Identification and functional characterization of a novel mutation in the calcium-sensing receptor gene in familial hypocalciuric hypercalcemia: modulation of clinical severity by vitamin D status.
17463182 2007 Wnt5a secretion stimulated by the extracellular calcium-sensing receptor inhibits defective Wnt signaling in colon cancer cells.
17426287 2007 Calcium-sensing receptor endocytosis links extracellular calcium signaling to parathyroid hormone-related peptide secretion via a Rab11a-dependent and AMSH-sensitive mechanism.
17374709 2007 The calcium-sensing receptor is a target of autoantibodies in patients with autoimmune polyendocrine syndrome type 1.
17374704 2007 Alanine to serine polymorphism at position 986 of the calcium-sensing receptor associated with coronary heart disease, myocardial infarction, all-cause, and cardiovascular mortality.
17372216 2007 An acquired hypocalciuric hypercalcemia autoantibody induces allosteric transition among active human Ca-sensing receptor conformations.
17332735 2007 R990G polymorphism of calcium-sensing receptor does produce a gain-of-function and predispose to primary hypercalciuria.
17331389 2007 [Association of calcium-sensing receptor gene polymorphism with serum calcium level in healthy young Han women in Beijing].
17320849 2007 Genetic variation at the calcium-sensing receptor (CASR) locus: implications for clinical molecular diagnostics.
17310098 2007 Stimulatory pathways of the Calcium-sensing receptor on acid secretion in freshly isolated human gastric glands.
17309124 2007 Interaction between birthweight and polymorphism in the calcium-sensing receptor gene in determination of adult bone mass: the Hertfordshire cohort study.
17284438 2007 Rescue of calcium-sensing receptor mutants by allosteric modulators reveals a conformational checkpoint in receptor biogenesis.
17138967 2007 The extracellular calcium-sensing receptor reciprocally regulates the secretion of BMP-2 and the BMP antagonist Noggin in colonic myofibroblasts.
17132283 2006 Serum calcium, urine calcium and polymorphisms of the calcium sensing receptor gene.
17124506 2007 The role of the calcium sensing receptor in regulating intracellular calcium handling in human epidermal keratinocytes.
17122384 2007 Interaction of the Ca2+-sensing receptor with the inwardly rectifying potassium channels Kir4.1 and Kir4.2 results in inhibition of channel function.
17110864 2006 Hypocalciuric hypercalcemia presenting as neonatal rib fractures: a newly described mutation of the calcium-sensing receptor gene.
17097611 2006 Ca2+ stimulates COX-2 expression through calcium-sensing receptor in fibroblasts.
17062884 2006 R990G polymorphism of the calcium-sensing receptor and renal calcium excretion in patients with primary hyperparathyroidism.
17054460 2006 Functional characterization of calcium sensing receptor polymorphisms and absence of association with indices of calcium homeostasis and bone mineral density.
17046587 2006 The human calcium-sensing receptor and interleukin-6 genes are associated with bone mineral density in Chinese.
17018660 2007 Primary hyperparathyroidism and the presence of kidney stones are associated with different haplotypes of the calcium-sensing receptor.
16938272 2006 Biophysical properties of the extra-cellular domain of the calcium-sensing receptor.
16854379 2006 AMSH regulates calcium-sensing receptor signaling through direct interactions.
16754659 2006 Stable association between G alpha(q) and phospholipase C beta 1 in living cells.
16740430 2006 Calcium-sensing receptor gene A986S polymorphism and bone mass in hypertensive women.
16738533 2006 Persistent hyperparathyroidism in renal allograft recipients: vitamin D receptor, calcium-sensing receptor, and apoptosis.
16735501 2006 A missense mutation in the seven-transmembrane domain of the human Ca2+ receptor converts a negative allosteric modulator into a positive allosteric modulator.
16642557 2006 A case report of familial benign hypocalciuric hypercalcemia: a mutation in the calcium-sensing receptor gene.
16622736 2006 Assessment of linkage and association of 13 genetic loci with bone mineral density.
16616098 2006 Localization and quantitative expression of the calcium-sensing receptor protein in human oocytes.
16608894 2006 A hypocalcemic child with a novel activating mutation of the calcium-sensing receptor gene: successful treatment with recombinant human parathyroid hormone.
16598859 2006 Identification of a novel inactivating R465Q mutation of the calcium-sensing receptor.
16596260 2006 The calcium-sensing receptor and vitamin D receptor expression in tertiary hyperparathyroidism.
16513638 2006 Calcium-sensing receptor ubiquitination and degradation mediated by the E3 ubiquitin ligase dorfin.
16509534 2006 A novel homozygous deletion in the calcium-sensing receptor ligand-binding domain associated with neonatal severe hyperparathyroidism.
16497624 2006 Mutations in the calcium-sensing receptor: a new genetic risk factor for chronic pancreatitis?
16472767 2006 Expression of a functional extracellular calcium-sensing receptor in human aortic endothelial cells.
16278666 2005 Upregulation of calcium-sensing receptor and mitogen-activated protein kinase signalling in the regulation of growth and differentiation in colon carcinoma.
16218047 Role of intron 5 C/T polymorphism of the calcium sensing receptor gene in the regulation of the serum FSH and LH in post-menopausal women.
16147994 2005 Delineating a Ca2+ binding pocket within the venus flytrap module of the human calcium-sensing receptor.
16117875 2005 Contribution of genotype and ethnicity to bone mineral density variation in Caucasians and Chinese: a test for five candidate genes for bone mass.
16109841 2005 The calcium-sensing receptor acts as a modulator of gastric acid secretion in freshly isolated human gastric glands.
15960151 2005 A case of gain-of-function mutation in calcium-sensing receptor: supplemental hydration is required for renal protection.
15888439 2005 A double mutation in the extracellular Ca2+-sensing receptor's venus flytrap domain that selectively disables L-amino acid sensing.
15879434 2005 Impaired cotranslational processing of the calcium-sensing receptor due to signal peptide missense mutations in familial hypocalciuric hypercalcemia.
15864123 2005 Calcium-sensing receptor gene polymorphism Arg990Gly and its possible effect on response to cinacalcet HCl.
15837785 2005 Amino acid-stimulated Ca2+ oscillations produced by the Ca2+-sensing receptor are mediated by a phospholipase C/inositol 1,4,5-trisphosphate-independent pathway that requires G12, Rho, filamin-A, and the actin cytoskeleton.
15805541 2005 Role of ceramide in Ca2+-sensing receptor-induced apoptosis.
15781005 2005 Genetic and environmental determinants of bone mineral density in Chinese women.
15718278 2005 Calcium-sensing receptor expression in human adipocytes.
15684428 2005 Calcium-sensing receptor gene transcription is up-regulated by the proinflammatory cytokine, interleukin-1beta. Role of the NF-kappaB PATHWAY and kappaB elements.
15657061 2005 High affinity interaction with filamin A protects against calcium-sensing receptor degradation.
15637145 2005 Beta-arrestin- and G protein receptor kinase-mediated calcium-sensing receptor desensitization.
15613438 2005 Increased gastrin and calcitonin secretion after oral calcium or peptones administration in patients with hypercalciuria: a clue to an alteration in calcium-sensing receptor activity.
15598778 2004 Association of genetic variants in the calcium-sensing receptor with risk of colorectal adenoma.
15591042 2005 A region in the seven-transmembrane domain of the human Ca2+ receptor critical for response to Ca2+.
15579740 2004 Severe hypercalcemia in a 9-year-old Brazilian girl due to a novel inactivating mutation of the calcium-sensing receptor.
15579475 2004 The Venus Fly Trap domain of the extracellular Ca2+ -sensing receptor is required for L-amino acid sensing.
15572418 2005 Functional characterization of calcium-sensing receptor codon 227 mutations presenting as either familial (benign) hypocalciuric hypercalcemia or neonatal hyperparathyroidism.
15551332 2005 A novel mutation (E767K) in the second extracellular loop of the calcium sensing receptor in a family with autosomal dominant hypocalcemia.
15531522 2004 Blood ionized calcium is associated with clustered polymorphisms in the carboxyl-terminal tail of the calcium-sensing receptor.
15501733 2004 [A986S polymorphism of calcium-sensing receptor gene is not related to bone mineral density or bone size in premenopausal Chinese women].
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15472173 2004 Parathyroid hormone gene polymorphism and sporadic idiopathic hypoparathyroidism.
15219850 2004 Extracellular calcium-sensing receptor transactivates the epidermal growth factor receptor by a triple-membrane-spanning signaling mechanism.
15201280 2004 pH Sensing by the calcium-sensing receptor.
14985373 2004 Genetic testing in familial isolated hyperparathyroidism: unexpected results and their implications.
14976203 2004 Positive and negative allosteric modulators of the Ca2+-sensing receptor interact within overlapping but not identical binding sites in the transmembrane domain.
14729680 2004 Modulation of interprotomer relationships is important for activation of dimeric calcium-sensing receptor.
14713274 2004 Prevalence of calcium sensing receptor autoantibodies in patients with sporadic idiopathic hypoparathyroidism.
14660633 2004 Homology modeling of the transmembrane domain of the human calcium sensing receptor and localization of an allosteric binding site.
14508624 2004 Calcium-sensing receptor gene polymorphism A986S does not predict serum calcium level, bone mineral density, calcaneal ultrasound indices, or fracture rate in a large cohort of elderly women.
12915654 2003 Recurrent familial hypocalcemia due to germline mosaicism for an activating mutation of the calcium-sensing receptor gene.
12914574 2003 Differentiation of Caucasians and Chinese at bone mass candidate genes: implication for ethnic difference of bone mass.
12899245 2003 Molecular and functional characterization of the extracellular calcium-sensing receptor in human colon cancer cells.
12890593 2003 Naturally occurring mutations of the extracellular Ca2+-sensing receptor: implications for its structure and function.
12783889 2003 m-Calpain colocalizes with the calcium-sensing receptor (CaR) in caveolae in parathyroid cells and participates in degradation of the CaR.
12773131 2003 Calcium-sensing receptor gene polymorphism is not associated with bone mineral density in Italian postmenopausal women.
12700051 2003 The calcium-sensing receptor in human disease.
12656660 2003 Decrease in vitamin D receptor and calcium-sensing receptor in highly proliferative parathyroid adenomas.
12605346 2003 Signaling of the human calcium-sensing receptor expressed in HEK293-cells is modulated by protein kinases A and C.
12574201 2003 Calcium sensing receptor gene A986S polymorphism and responsiveness to calcium supplementation in postmenopausal women.
12574188 2003 Autosomal dominant hypocalcemia: a novel activating mutation (E604K) in the cysteine-rich domain of the calcium-sensing receptor.
12544508 2003 A microarray minisequencing system for pharmacogenetic profiling of antihypertensive drug response.
12517779 2003 Extracellular calcium and calcium sensing receptor function in human colon carcinomas: promotion of E-cadherin expression and suppression of beta-catenin/TCF activation.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12469911 2002 Familial hypocalciuric hypercalcemia caused by an R648stop mutation in the calcium-sensing receptor gene.
12459170 2002 The extracellular calcium Ca2+o-sensing receptor is expressed in myeloma cells and modulates cell proliferation.
12409307 2002 Protein kinase C (PKC) phosphorylation of the Ca2+ o-sensing receptor (CaR) modulates functional interaction of G proteins with the CaR cytoplasmic tail.
12399473 2002 Calcium sensing receptor activation by a calcimimetic suggests a link between cooperativity and intracellular calcium oscillations.
12241879 2002 Association between activating mutations of calcium-sensing receptor and Bartter's syndrome.
12239240 2002 Influence of calcium-sensing receptor gene on urinary calcium excretion in stone-forming patients.
12150336 Calcium-sensing receptor gene polymorphisms in primary hyperparathyroidism.
12107202 2002 Hydrochlorothiazide effectively reduces urinary calcium excretion in two Japanese patients with gain-of-function mutations of the calcium-sensing receptor gene.
12095982 2002 Three adjacent serines in the extracellular domains of the CaR are required for L-amino acid-mediated potentiation of receptor function.
12052452 2002 Lack of association between calcium-sensing receptor gene "A986S" polymorphism and bone mineral density in Hungarian postmenopausal women.
12050233 2002 A family of autosomal dominant hypocalcemia with a positive correlation between serum calcium and magnesium: identification of a novel gain of function mutation (Ser(820)Phe) in the calcium-sensing receptor.
12040821 2002 Vitamin D and calcium-sensing receptor genotypes in men and premenopausal women with low bone mineral density.
12036954 2002 Human calcium-sensing receptor gene. Vitamin D response elements in promoters P1 and P2 confer transcriptional responsiveness to 1,25-dihydroxyvitamin D.
12018449 2002 Calcium-sensing receptor A986S polymorphism in human rectal cancer.
11984699 2002 Association of gene polymorphisms and bone density in Japanese girls.
11907035 2002 Parallel activation of phosphatidylinositol 4-kinase and phospholipase C by the extracellular calcium-sensing receptor.
11762699 2001 A novel mutation in Ca2+-sensing receptor gene in familial hypocalciuric hypercalcemia.
11589681 2001 Association of polymorphic alleles of the calcium-sensing receptor gene with the clinical severity of primary hyperparathyroidism.
11390380 2001 Filamin-A binds to the carboxyl-terminal tail of the calcium-sensing receptor, an interaction that participates in CaR-mediated activation of mitogen-activated protein kinase.
11390379 2001 Interaction of the calcium-sensing receptor and filamin, a potential scaffolding protein.
11248745 2001 Calcium sensing receptor gene polymorphism, circulating calcium concentrations and bone mineral density in healthy adolescent girls.
11161843 2001 Association between total serum calcium and the A986S polymorphism of the calcium-sensing receptor gene.
11108243 2000 Extracellular calcium-sensing receptor expression and its potential role in regulating parathyroid hormone-related peptide secretion in human breast cancer cell lines.
11095989 2000 A patient with type 2 diabetes mellitus associated with mutations in calcium sensing receptor gene and mitochondrial DNA.
11013439 2000 Mutations of the calcium-sensing receptor (CASR) in familial hypocalciuric hypercalcemia, neonatal severe hyperparathyroidism, and autosomal dominant hypocalcemia.
10843194 2000 Familial hypercalcemia and hypercalciuria caused by a novel mutation in the cytoplasmic tail of the calcium receptor.
10487661 1999 Autosomal dominant hypoparathyroidism associated with short stature and premature osteoarthritis.
10468915 1999 An adult patient with severe hypercalcaemia and hypocalciuria due to a novel homozygous inactivating mutation of calcium-sensing receptor.
10405337 1999 High extracellular calcium inhibits osteoclast-like cell formation by directly acting on the calcium-sensing receptor existing in osteoclast precursor cells.
10023897 1999 A986S polymorphism of the calcium-sensing receptor and circulating calcium concentrations.
9920407 1998 Disorders of the calcium-sensing receptor.
9920108 1999 A novel activating mutation in calcium-sensing receptor gene associated with a family of autosomal dominant hypocalcemia.
9852126 1998 Identification of the sites of N-linked glycosylation on the human calcium receptor and assessment of their role in cell surface expression and signal transduction.
9722601 1998 Dimerization of the extracellular calcium-sensing receptor (CaR) on the cell surface of CaR-transfected HEK293 cells.
9694886 1998 Protein kinase C phosphorylation of threonine at position 888 in Ca2+o-sensing receptor (CaR) inhibits coupling to Ca2+ store release.
9677383 1998 Sodium and ionic strength sensing by the calcium receptor.
9661634 1998 Familial hypoparathyroidism: identification of a novel gain of function mutation in transmembrane domain 5 of the calcium-sensing receptor.
9298824 1997 A novel mutation (L174R) in the Ca2+-sensing receptor gene associated with familial hypocalciuric hypercalcemia.
9253359 1997 Two novel missense mutations in calcium-sensing receptor gene associated with neonatal severe hyperparathyroidism.
9253358 1997 Sporadic hypoparathyroidism caused by de Novo gain-of-function mutations of the Ca(2+)-sensing receptor.
9217223 1997 Neonatal severe hyperparathyroidism, secondary hyperparathyroidism, and familial hypocalciuric hypercalcemia: multiple different phenotypes associated with an inactivating Alu insertion mutation of the calcium-sensing receptor gene.
9168937 1997 Expression of extracellular calcium-sensing receptor by human lens epithelial cells.
8813042 1996 A familial syndrome of hypocalcemia with hypercalciuria due to mutations in the calcium-sensing receptor.
8756555 1996 Expression of a calcium-sensing receptor in a human medullary thyroid carcinoma cell line and its contribution to calcitonin secretion.
8733126 1996 Mutations in the Ca(2+)-sensing receptor gene cause autosomal dominant and sporadic hypoparathyroidism.
8702647 1996 Expression and characterization of inactivating and activating mutations in the human Ca2+o-sensing receptor.
8698326 1996 The Ca(2+)-sensing receptor gene (PCAR1) mutation T151M in isolated autosomal dominant hypoparathyroidism.
8675635 1995 Calcium-sensing receptor mutations in familial benign hypercalcemia and neonatal hyperparathyroidism.
8613532 1996 Changes in calcium responsiveness and handling during keratinocyte differentiation. Potential role of the calcium receptor.
8597637 1995 Mapping of the calcium-sensing receptor gene (CASR) to human chromosome 3q13.3-21 by fluorescence in situ hybridization, and localization to rat chromosome 11 and mouse chromosome 16.
7916660 1993 Mutations in the human Ca(2+)-sensing receptor gene cause familial hypocalciuric hypercalcemia and neonatal severe hyperparathyroidism.
7874174 1994 Autosomal dominant hypocalcaemia caused by a Ca(2+)-sensing receptor gene mutation.
7759551 1995 Molecular cloning and functional expression of human parathyroid calcium receptor cDNAs.
7726161 1995 Mutations in the human Ca(2+)-sensing-receptor gene that cause familial hypocalciuric hypercalcemia.
7677761 1995 Molecular cloning of a putative Ca(2+)-sensing receptor cDNA from human kidney.
7673400 1995 Familial hypocalciuric hypercalcemia associated with mutation in the human Ca(2+)-sensing receptor gene.