Property Summary

NCBI Gene PubMed Count 61
PubMed Score 89.38
PubTator Score 83.55

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
acute quadriplegic myopathy 1.138 1.3e-03
colon cancer -5.000 1.3e-05
Duchenne muscular dystrophy 1.223 8.9e-06
invasive ductal carcinoma -1.300 2.3e-02
juvenile dermatomyositis 1.242 1.1e-08
lung adenocarcinoma -1.200 3.6e-10
lung cancer -2.300 1.7e-02
non-small cell lung cancer -1.365 2.3e-23
ovarian cancer 1.600 7.2e-11
psoriasis -1.700 2.6e-55

Gene RIF (37)

AA Sequence

MKRTHLFIVGIYFLSSCRAEEGLNFPTYDGKDRVVSLSEKNFKQVLKKYDLLCLYYHEPVSSDKVTQKQF      1 - 70
QLKEIVLELVAQVLEHKAIGFVMVDAKKEAKLAKKLGFDEEGSLYILKGDRTIEFDGEFAADVLVEFLLD     71 - 140
LIEDPVEIISSKLEVQAFERIEDYIKLIGFFKSEDSEYYKAFEEAAEHFQPYIKFFATFDKGVAKKLSLK    141 - 210
MNEVDFYEPFMDEPIAIPNKPYTEEELVEFVKEHQRPTLRRLRPEEMFETWEDDLNGIHIVAFAEKSDPD    211 - 280
GYEFLEILKQVARDNTDNPDLSILWIDPDDFPLLVAYWEKTFKIDLFRPQIGVVNVTDADSVWMEIPDDD    281 - 350
DLPTAEELEDWIEDVLSGKINTEDDDEDDDDDDNSDEEDNDDSDDDDDE                         351 - 399
//

Text Mined References (63)

PMID Year Title