Property Summary

NCBI Gene PubMed Count 298
PubMed Score 2135.89
PubTator Score 1651.83

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
adrenocortical carcinoma -2.692 1.7e-09
tuberculosis -1.100 5.6e-05

Gene RIF (269)

PMID Text
27141571 Renal CASP9 expression is increased in diabetes and increased as diabetic nephropathy progressed.
26323553 Results show that mRNA and protein levels of HAX-1 in prostate cancer cell lines were significantly higher and inhibits cell apoptosis through caspase-9 inactivation.
26290316 Inhibition of Caspase-9 restricted, while Apaf-1 promoted, Chlamydia pneumoniae infection in HEp-2, HeLa, and mouse epithelial fibroblast (MEF) cells.
26024713 interaction of rmEMMPRINex with U937 cells leads to inhibition of MCT1 membrane expression, intracellular activation of procaspase-9, followed by DNA fragmentation and apoptosis.
26014377 Inhibition of Mcl-1 and activation of caspases are critically involved in gallotannin-induced apoptosis in prostate cancer cells.
25815518 VPA and ATO had synergistic effects on the proliferation of RPMI8226 cells, which may have been associated with the decreased expression of Bcl-2 and the increased expression levels of Bcl-2-associated X protein, Caspase 8 and Caspase 9
25665064 Silver nanoparticles biosynthesized using Achillea biebersteinii flower extract: apoptosis induction in MCF-7 cells via caspase activation and regulation of Bax and Bcl-2 gene expression.
25569260 Expression of mutant caspase-9 correlated with a downregulation of BAFFR (B-cell-activating factor belonging to the TNF family (BAFF) receptor) in B cells and ICOS (inducible T-cell costimulator) in T cells.
25370148 Levels of caspase-9, caspase-10, MAVS, and pIRF7 in mononuclear cells and the disease activity index (SLEDAI) in the systemic lupus erythematosus patients were determined.
25356864 caspase-9 mediates Puma activation to determine the threshold for overcoming chemoresistance in cancer cells.
25330190 We have also demonstrated that these correlations are tissue specific being reduced (CASP9 and CASP10) or different (CASP2) in the liver
25214386 Studied the mechanism of Artemisinin (ARTE)-induced human lung adenocarcinoma (ASTC-a-1) cell apoptosis; results showed ARTE induced the activation of caspase-3, -8 and -9.
25059065 soluble apoptosis markers as sFas-L, Caspase-9, Caspase-8 and sCD153 were significantly higher in stage III obesity patients compared obese patients without food allergy
25031754 we suggest that phosphorylation of caspase-9 may be a useful tool to assess the state of gastrointestinal cancer and the effects of anti-cancer therapy.
24980229 lower expression in patients with chronic rhinosinusitis with nasal polyposis
24886575 HIV-1 protease directly cleaves and activates procaspase 8 in T cells which is associated with cleavage of BID, mitochondrial release of cytochrome c, activation of the downstream caspases 9 and 3, and cleavage of DFF and PARP
24879622 Data indicate a significant association of two single nucleotide polymorphism (SNPs) in aspase9 (CASP9) and two haplotypes of the four SNP combinations with acute myeloid leukemia (AML) susceptibility.
24839934 Data confirmed that levels of PinX1 and caspase 3, 8 and 9 expression were closely linked to the poor prognosis of colorectal cancer.
24661197 silica and double-stranded RNA (dsRNA) synergistically induces caspase-9-dependent apoptosis, but not inflammasome activation, of bronchial epithelial cells
24592539 The change of caspase-9 expression from colon mucosa, adenoma to cancer suggested it may be involved in the carcinogenesis of colon cancer.
24556695 HIV-1 protease directly cleaves and activates procaspase 8 in T cells which is associated with cleavage of BID, mitochondrial release of cytochrome c, activation of the downstream caspases 9 and 3, and cleavage of DFF and PARP
24530529 Apoptotic progression is markedly attenuated by ATM gene knockdown through downregulation of caspase-8 and caspase-9.
24427328 that KAT5 RNAi may result in cleaved casp9 upregulation through p38MAPK activation in Gallbladder carcinoma cells
24424093 The inhibitory effect of Ab42 on the apoptotic pathway is associated with its interaction with procaspase-9 and consequent inhibition of Apaf-1 apoptosome assembly
24405603 overexpression of iASPP and the low expression of caspase-9 in esophageal cancer are closely correlated with tumor invasion and metastasis
24377517 DNA fragmentation, DNA damage, caspase-9 activation and a large increase in the sub-G1 and S cell cycle phases confirmed the occurrence of apoptosis in a time-dependent manner.
24362031 the Atg7.caspase-9 complex performs a dual function of linking caspase-9 to the autophagic process while keeping in check its apoptotic activity.
24346702 dCas9 effectors can exert positive or negative regulation on the expression of developmentally relevant genes, which can influence cell differentiation status when impinging on a key node in the regulatory network that governs the cell state.
24161344 MA-1 treatment causes release of cytochrome c into the cytosol, leading to activation of caspases 3 and 9.
23867824 Reduced cathepsin B expression, effected by RNA interference, mimicked pharmacological inhibition of the enzyme and confirmed the contribution of cathepsin B to apoptotic events induced by DENV in HepG2 cells.
23732112 HIV-1 protease directly cleaves and activates procaspase 8 in T cells which is associated with cleavage of BID, mitochondrial release of cytochrome c, activation of the downstream caspases 9 and 3, and cleavage of DFF and PARP
23725396 CASP-9 polymorphisms are associated with susceptibility to low back pain during military training in Chinese soldiers.
23652278 OSU-03012 induces apoptosis in human esophageal carcinoma cells through a p53/Bax/cytochrome c/caspase-9-dependent pathway.
23645041 BIRC5-31CC and CASP9+83CT/TT genotypes were associated with an increased risk for renal cell carcinoma development in the female group of our southern European study population.
23615977 EGCG, both alone and in combination with cisplatin, promoted the expression of the pro-apoptotic splice isoform of caspase 9
23572523 Proteolytic processing of the caspase-9 zymogen is required for apoptosome-mediated activation of caspase-9
23479167 The rs4645981 T allele and the rs4645981 T allele carrier might increase the risk of cancer, but the rs1052576 A allele, rs1052576 A carrier, rs2308941 T allele, and rs2308941 T carrier might be protective.
23443079 siRNA-based gene inactivation of caspase-8 effectively delays caspase-9 activation and apoptosis induced by G-Rh2, indicating that caspase-8 also plays an important role in the G-Rh2-induced apoptosis program.
23424205 The results demonstrated that 50 microg/mL beta-glucan significantly repressed the expression of the ERCC5 gene, no change in CASP9 expression, and induction of the CYP1A1 gene.
23396972 Induction of caspase-9b expression is due to activation of hnRNP L via phosphorylation to compete/inhibit hnRNP U association with exon 3 of Casp9 mRNA.
23364796 HIV-1 protease directly cleaves and activates procaspase 8 in T cells which is associated with cleavage of BID, mitochondrial release of cytochrome c, activation of the downstream caspases 9 and 3, and cleavage of DFF and PARP
23359247 In oligozoospermia, spermatogonia presented significant increased active caspase-9
23303631 Results found that polymorphisms of CASP9 and CASP10 genes may not contribute to CRC risk in Chinese population.
23203690 Interactions of caspase-9 with the BIR3 (baculovirus inhibitory repeat 3) exosite are essential for high-affinity binding.
23202514 HIV-1 protease directly cleaves and activates procaspase 8 in T cells which is associated with cleavage of BID, mitochondrial release of cytochrome c, activation of the downstream caspases 9 and 3, and cleavage of DFF and PARP
23109891 EG also activated the death receptor-dependent pathway of apoptosis by enhancing the expression of caspases-8, -9, and -3 and the Bcl-2 interacting domain (Bid).
23038270 caspase-9 is the most important regulator in DLD-1, HCT-116, and HeLa cells
22981751 CASP9 promoter polymorphisms rs4645978 and rs4645981 are associated with breast cancer susceptibility; CASP9 transcriptional regulation is an important factor during breast cancer development
22974165 The overexpression of c-Jun, p73 and Casp-9 in thymic epithelial tumors is closely related with the pathogenesis and biological behavior of the neoplasms.
22944165 Atorvastatin inhibits the H2O2-induced apoptosis of ECV-304 cells in a dose-dependent manner by downregulating casp3 and casp9.
22926545 Data indicate that daidzein induced a change in the Bax/Bcl-2 ratios and activation of caspases-3 and -9 and the cleavage of PARP, and therefore has the potential for use as a therapeutic agent for the treatment of gastric carcinoma.
22683311 The binding of CSR1 with XIAP enhanced caspase-9 and caspase-3 protease activities.
22679284 data support the view that the Ptc dependence receptor specifically allows the activation of caspase-9 via its ubiquitination, which occurs via the recruitment by Ptc of NEDD4
22629415 HIV-1 protease directly cleaves and activates procaspase 8 in T cells which is associated with cleavage of BID, mitochondrial release of cytochrome c, activation of the downstream caspases 9 and 3, and cleavage of DFF and PARP
22616010 caspase 9 rs4645978 most contributes to decreased susceptibility to cancer in Caucasians and prostate cancer. rs105276, the A allele might be a protective factor for cancer for Asians. rs4645981 confers increased susceptibility to lung cancer in Asians.
22573662 The study identified two distinct zinc-binding sites on caspase-9.
22552851 HIV-1 protease directly cleaves and activates procaspase 8 in T cells which is associated with cleavage of BID, mitochondrial release of cytochrome c, activation of the downstream caspases 9 and 3, and cleavage of DFF and PARP
22339913 Caspase-8 and caspase-9 expression was reduced in patients with chronic mountain sickness.
22306364 Data suggest that CD95L-triggered endogenous ceramide increase in Jurkat leukemia T cells is likely involved in the pro-apoptotic mitochondrial pathway leading to caspase-9 activation.
22219640 HIV-1 protease directly cleaves and activates procaspase 8 in T cells which is associated with cleavage of BID, mitochondrial release of cytochrome c, activation of the downstream caspases 9 and 3, and cleavage of DFF and PARP
22191568 A dose-dependent increase in the activities of caspase-9 and caspase-3 coinciding with elevation of CK18 levels was found in bromelain-treated breast cancer cells.
22120515 Polymorphism in Caspase 9 (-1263 A>G) was observed to be associated with susceptibility of papillary thyroid carcinoma (PTC).
22086301 These results clearly indicated that olive oil phenolic extract and gallic acid were able to inhibit the caspase 9 dependent apoptosis pathway in HeLa cells.
21957492 The ectopic expression of caspase 9 induced the formation of the sp1-p53 complex and that this complex binds to the sp1 recognition site residing within the ERR-1 of the LTR.
21944661 Data show that the proliferation inhibitory effect of SKLB703 was associated with its apoptosis-inducing effect by activating caspase-3 and caspase-9.
21869827 Translocation of ARTS initiates a first wave of caspase activation leading to the subsequent release of additional mitochondrial factors, including cytochrome C and SMAC/Diablo.
21868008 Sperm caspase-9 is up-regulated in oligoasthenoteratozoospermic men with varicocele.
21827945 procaspase-9 and caspase-3 have overlapping binding sites on the central hub of the apoptosome which play a crucial role in their activation
21785112 Data indicate that NGA could increase the expression of the apoptosis-related proteins FasL, caspase-3, caspase-8, caspase-9, and Bax and decrease the expression of anti-apoptotic protein Bcl-2 accompanied by the mitochondrial transmembrane damage.
21757755 analysis of structural determinants of caspase-9 inhibition by the vaccinia virus protein, F1L
21724551 Mechanistic studies showed that MLN2238-triggered apoptosis is associated with activation of caspase-3, caspase-8, and caspase-9.
21659556 These results suggest that, in addition to the classical cytochrome c/Apaf-1-dependent pathway of caspase-9 activation, staurosporine can induce caspase-9 activation and apoptosis independently of the apoptosome.
21644232 the CASP9 rs4646018 polymorphism may not be related to the stomach cancer risk
21622622 a novel intronic splicing enhancer that regulates caspase 9 RNA splicing and specifically interacts with SRSF1 was identified.
21612408 p53 mediates DNA damaging doxorubicin-induced apoptosis in neurobblastoma IMR32 cells through the caspase-9 pathway.
21565459 In addition to increased caspase-3 like activity as assessed by the cleavage of DEVD-pNA, caspase-9 was also cleaved indicating the activation of the intrinsic apoptosis pathway.
21555338 DNA fragmentation was accompanied by increased caspase-9 and caspase-3 activities.
21538054 The association between CASP8 and CASP9 gene polymorphisms and colorectal cancer (CRC) susceptibility, was investigated.
21483669 HIV-1 protease directly cleaves and activates procaspase 8 in T cells which is associated with cleavage of BID, mitochondrial release of cytochrome c, activation of the downstream caspases 9 and 3, and cleavage of DFF and PARP
21461653 Caspase 9 1263 A>G polymorphism was observed to play a protective role in gastric cancer predisposition.
21396853 results suggested that the CASP 8 IVS12-19G/A and CASP 9 -1263 polymorphism may be involved in etiology of prostate cancer
21382445 Data suggest that mainly caspase-3 and -9 participate in the agaritine induced apoptotic pathway.
21297999 in the absence of nucleotide such as ATP, direct association of procaspase-9 with Apaf-1 leads to defective molecular timer, and thus, inhibits apoptosome-mediated caspase activation
21284734 Caspase-9 expression and the apoptosis in gastric adenocarcinoma cells in ascitic fluid. Patients with low caspase-9 expression showed significantly shorter survival (p < 0.05) than those with high caspase-9 expression.
21282934 results suggest that caspase-4 directly activates caspase-9 by the processing of procaspase-9 at Asp-315 in endoplasmic reticulum stress-induced neuronal apoptosis
21266831 caspase-9 activation precedes cytochrome c release and translocation during hypoxia-induced apoptosis in neuroepithelioma SK-N-MC cells
21178828 Data show that the expression of apoptosis proteins caspase-3,-8,-9, and Bid in the RNP of the disc and the SNP was different in each patient.
21142842 Activation of caspases 3/7 and 9 was detected during study of the mechanism by which amine-modified polystyrene nanoparticles induce cell death in a human brain astrocytoma cell line.
21117896 This study suggests that the single nucleotide polymorphism in the caspase 9 Ex5 + 32 G/A may be associated with lumbar disc herniation and disc degeneration in the Han population of northern China.
21091209 The CASP-9 -1263A/G polymorphism is associated with a high risk of discogenic low back pain.
21048031 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
21045158 Findings show that oncogenic factors activating the phosphoinositide 3-kinase/Akt pathway can regulate alternative splicing of Casp9 via a coordinated mechanism involving the phosphorylation of SRp30a.
20978129 Activation of caspase-9, but not caspase-2 or caspase-8, is essential for heat-induced apoptosis in Jurkat cells.
20959405 Observational study of gene-disease association. (HuGE Navigator)
20887385 Significant haplotype associations between CASP9 and inflammatory bowel disease were identified, while no association of RUNX3 haplotypes with either ulcerative colitis or Crohn's disease was found
20887385 Observational study of gene-disease association. (HuGE Navigator)
20855536 We replicated the association of BCL2L11 and CASP9 with non-Hodgkin's lymphoma risk at the gene and SNP level, and identified novel associations with BCLAF1 and BAG5.
20855536 Observational study of gene-disease association. (HuGE Navigator)
20804486 promoter polymorphisms of CASP9 may have influence on the CASP9 promoter activity and are therefore significantly associated with reduced risk of prostate cancer, indicating that this variant allele may confer protection against prostate cancer.
20804486 Observational study of gene-disease association. (HuGE Navigator)
20800603 Observational study of gene-disease association. (HuGE Navigator)
20667824 cIAP1 cooperatively interacts with oligomerized processed caspase-9 in the apoptosome and blocks procaspase-3 activation.
20661084 Single Nucleotide Polymorphisms in CASP9 is asspciated with lung cancer.
20661084 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20650551 None of the polymorphisms analyzed influenced disease susceptibility and/or activity, but a high intake of total, saturated and monounsaturated fats and a higher ratio of n-6/n-3 polyunsaturated fatty acids, was associated with a more active phenotype.
20650551 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20644561 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20490276 Show evidence that insulin is capable of reducing cytotoxicity, and demonstrate that the recovery of the cell viability is obtained by inhibition of intrinsic apoptotic program, triggered by A-beta and involving caspase 9 and 3 activation.
20453000 Observational study of gene-disease association. (HuGE Navigator)
20404718 HIV-1 protease directly cleaves and activates procaspase 8 in T cells which is associated with cleavage of BID, mitochondrial release of cytochrome c, activation of the downstream caspases 9 and 3, and cleavage of DFF and PARP
20402676 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20357690 caspase-9 G allele confers increased susceptibility to pancreatic cancer development, and the survivin C carriage status may be related to aggressive features of this malignancy.
20357690 Observational study of gene-disease association. (HuGE Navigator)
20340172 HIV-1 protease directly cleaves and activates procaspase 8 in T cells which is associated with cleavage of BID, mitochondrial release of cytochrome c, activation of the downstream caspases 9 and 3, and cleavage of DFF and PARP
20227384 it is the specific nitration of solvent-exposed Tyr74 which enhances the peroxidase activity and blocks the ability of cytochrome c to activate caspase-9, thereby preventing the apoptosis signaling pathway
20227371 Mitochondrial and cytosolic transfer RNA (tRNA) bind to cytochrome c preventing cytochrome c interaction with Apaf-1, blocking Apaf-1 oligomerization and caspase activation.
20071584 Results indicate HSV-2-induced apoptosis in T cells occurs via the intrinsic pathway and requires caspase 9.
20060927 Resveratrol significantly enhanced cigarette smoke-stimulated caspase 3 and caspase 9 activity in human bronchial epithelial cells.
20042134 rhEPO can significantly inhibit the activity of caspase-3 or caspase-9 in endothelial cell apoptosis in a dose-dependent manner.
20022954 An N-terminal region of F1L preceding the Bcl-2-like fold accounts for caspase-9 inhibition and significantly contributes to the anti-apoptotic activity of F1L.
20013803 High caspase-9 expression is associated with colon carcinoma.
20012528 HIV-1 protease directly cleaves and activates procaspase 8 in T cells which is associated with cleavage of BID, mitochondrial release of cytochrome c, activation of the downstream caspases 9 and 3, and cleavage of DFF and PARP
19913121 Observational study of gene-disease association. (HuGE Navigator)
19906200 during intrinsic apoptosis, caspase-9 can feed back to mitochondria to induce cytochrome c release and collapse of DeltaPsim.
19895210 HIV-1 protease directly cleaves and activates procaspase 8 in T cells which is associated with cleavage of BID, mitochondrial release of cytochrome c, activation of the downstream caspases 9 and 3, and cleavage of DFF and PARP
19826114 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19807657 The presence of FoxO3a is necessary for the expression of cleaved (active) caspase 3, 8, and 9
19789190 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
19773279 Observational study of gene-disease association. (HuGE Navigator)
19770581 Data show that EGCG inhibited KIT activity after 4 h treatment, and induced cell death via caspase-dependent pathways.
19758996 Findings strongly suggest that Fas-mediated activation of executioner caspases and induction of apoptosis do not depend on apoptosome-mediated caspase-9 activation in prototypical type II cells.
19741144 The caspase-9-cleaved form of Sema7A reveals abundant caspase-9-activated cells in 2-year-old (aged) but not in 2-month-old (young) mice.
19724860 Overexpression of Notch1 in laryngeal carcinoma cell line was associated with upregulation of caspase 9
19692467 HIV-1 protease directly cleaves and activates procaspase 8 in T cells which is associated with cleavage of BID, mitochondrial release of cytochrome c, activation of the downstream caspases 9 and 3, and cleavage of DFF and PARP
19692168 Observational study of gene-disease association. (HuGE Navigator)
19674438 HIV-1 protease directly cleaves and activates procaspase 8 in T cells which is associated with cleavage of BID, mitochondrial release of cytochrome c, activation of the downstream caspases 9 and 3, and cleavage of DFF and PARP
19655415 Data show that magnolol inhibited H2O2-induced expressions of caspase-9 and caspase-3 and reduction of Bcl-2/Bax ratio.
19626422 UTP- and thapsigargin-induced caspase-3 and caspase-9 activation and mitochondrial membrane depolarization is dependent on rises in [Ca(2+)](c) in human myeloid HL-60 cells
19625176 Observational study of gene-disease association. (HuGE Navigator)
19573080 Observational study of gene-disease association. (HuGE Navigator)
19550122 Data show that the mDRA-6-induced apoptosis was repressed by 77.9% by Caspase-8 inhibitor ZIF, 54.2% by Caspase-3 inhibitor ZDF, and 8.7% by Caspase-9 inhibitor ZLF, but was not repressed by Caspase-10 inhibitor ZAF.
19493480 Caspase-9 may be an important mediator of apoptosis in keratinocytes induced by trichloroethylene.
19465923 Data suggest that in the absence of its ligand Shh the dependence receptor Patched serves as the anchor for a caspase-activating complex that includes DRAL, and caspase-9.
19458171 HIV-1 protease directly cleaves and activates procaspase 8 in T cells which is associated with cleavage of BID, mitochondrial release of cytochrome c, activation of the downstream caspases 9 and 3, and cleavage of DFF and PARP
19414860 Observational study of gene-disease association. (HuGE Navigator)
19412632 Polymorphism in Caspase 9-1263 was observed to play a protective role in susceptibility to BC risk. Caspase 9 gene variants were also associated with reduced risk of NMBIC stages.
19412632 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19359048 Our results suggest that the presence of the G/G genotype represents a higher risk factor in our MS population and a differential production of CASP-9 might be a contributory factor in determining the severity of MS.
19359048 Observational study of gene-disease association. (HuGE Navigator)
19275587 HIV-1 protease directly cleaves and activates procaspase 8 in T cells which is associated with cleavage of BID, mitochondrial release of cytochrome c, activation of the downstream caspases 9 and 3, and cleavage of DFF and PARP
19275586 HIV-1 protease directly cleaves and activates procaspase 8 in T cells which is associated with cleavage of BID, mitochondrial release of cytochrome c, activation of the downstream caspases 9 and 3, and cleavage of DFF and PARP
19275584 HIV-1 protease directly cleaves and activates procaspase 8 in T cells which is associated with cleavage of BID, mitochondrial release of cytochrome c, activation of the downstream caspases 9 and 3, and cleavage of DFF and PARP
19275583 HIV-1 protease directly cleaves and activates procaspase 8 in T cells which is associated with cleavage of BID, mitochondrial release of cytochrome c, activation of the downstream caspases 9 and 3, and cleavage of DFF and PARP
19269008 Observational study of gene-disease association. (HuGE Navigator)
19238172 The oxidative modification of caspase-9 by reactive oxygen species can mediate its interaction with apoptotic protease-activating factor 1, and can promote its formation of disulfide-linked complexes.
19219602 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19183163 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19170196 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19159073 Extracellular adenosine induces apoptosis in Caco-2 cells by activating caspase-9 and the downstream effector caspase caspase-3 in association with mitochondrial damage via A(2a) adenosine receptors.
19141860 Observational study of gene-disease association. (HuGE Navigator)
19081073 DYRK1A regulates caspase-9-mediated apoptosis during retina development
19074885 Observational study of gene-disease association. (HuGE Navigator)
19058789 Observational study of gene-disease association. (HuGE Navigator)
19052714 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19016842 Regulation of apoptosis through inhibitory phosphorylation of caspase 9 may play a role in the function of DYRK1A during development and in pathogenesis.
19013323 HIV-1 protease directly cleaves and activates procaspase 8 in T cells which is associated with cleavage of BID, mitochondrial release of cytochrome c, activation of the downstream caspases 9 and 3, and cleavage of DFF and PARP
18840411 an apoptotic inhibitory complex comprised of DR5, FADD, caspase-8, and c-FLIP(L) exists in MCF-7 cells, and the absence of c-FLIP(L) from this complex induces DR5- and FADD-mediated caspase-8 activation in the death inducing signaling complex
18814044 Results describe the immunohistochemical distribution of caspase 3, 9 and Bax in intracranial U87 glioblastoma xenografts, and show that xenografts contain cells positive for caspase-3, caspase-9, and Bax.
18813792 the simultaneous downregulation of uPAR and MMP-9 induces apoptosome-mediated apoptosis through FADD-associated protein RIP and caspase 9
18723680 Caspase-3 and caspase-7 exhibit differential activity toward multiple substrate proteins, including Bid, XIAP, gelsolin, caspase-6, and cochaperone p23.
18676680 Observational study of gene-disease association. (HuGE Navigator)
18632964 These results illustrate that JEV infection triggers caspase cascades involving the initiators caspase-8 and -9, probably through FADD-independent but mitochondrion-dependent pathways.
18415681 It is concluded that P. aeruginosa can induce apoptosis with an up-regulated expression of Bax and a down-regulated expression of Bcl-2, which resulted in increased levels of cytochrome c release and increased caspase-3 and -9 in human U937 cells.
18381704 Observational study of gene-disease association. (HuGE Navigator)
18297401 Western blotting suggests that vinorelbine cleaves caspase-3, -9 and -8 and reduces the amount of mitochondrial cytochrome c.
18202770 the induction of apoptosis through the inhibition of endogenous FGF signaling is caspase-9 pathway- dependent
18086147 Melatonin maintains mitochondrial membrane potential and attenuates activation of initiator (casp-9) and effector caspases (casp-3/casp-7) and PARP in UVR-exposed HaCaT keratinocytes
18083711 Arg(10) in the D domain of caspase-9 interacts with Asp(160) in the TTCD motif of ERK2. Differences in the TTCD motif in other MAPK family members could account for the selective recognition of caspase-9 by ERK1/2
18054197 Enteropathogenic Escherichia coli induced apoptosis in T84 intestinal epithelial cells via induction of caspases-3, -8, and -9.
17967742 HIV-1 protease directly cleaves and activates procaspase 8 in T cells which is associated with cleavage of BID, mitochondrial release of cytochrome c, activation of the downstream caspases 9 and 3, and cleavage of DFF and PARP
17899380 characterization of the caspase 9 signaling cascade; data provide novel insights into the ordering of a caspase signaling network downstream of caspase-9 in intact cells during apoptosis
17893147 a caspase-9 signaling cascade induces feedback disruption of the mitochondrion through cleavage of anti-apoptotic Bcl-2, Bcl-xL, and Mcl-1
17653867 HIV-1 protease directly cleaves and activates procaspase 8 in T cells which is associated with cleavage of BID, mitochondrial release of cytochrome c, activation of the downstream caspases 9 and 3, and cleavage of DFF and PARP
17626072 Bortezomib induced apoptosis of EBV lymphoblastoid cell lines (LCLs) by inducing cleavage of caspases 8 and 9
17534194 Observational study of gene-disease association. (HuGE Navigator)
17466630 phosphorylation of caspase-9 at Thr125 sets the threshold for activation of the intrinsic apoptotic pathway during the cell cycle
17437405 Results demonstrate that cleavage by caspase 3 does not activate caspase 9, but enhances apoptosis by alleviating XIAP inhibition of the apical caspase.
17409234 HIV-1 protease directly cleaves and activates procaspase 8 in T cells which is associated with cleavage of BID, mitochondrial release of cytochrome c, activation of the downstream caspases 9 and 3, and cleavage of DFF and PARP
17379327 caspases-3 and caspase-9 play novel roles in transcription by regulating polycomb protein function through direct cleaving of Ring1B.
17299206 These results indicate that resveratrol seems to exert its growth-inhibitory/apoptotic effect on the breast cancer cell line MCF7 via the Akt-caspase-9 pathway.
17291493 Endogenously expressed XIAP bound active forms of both caspase-9 and caspase-3. However, downregulation of XIAP were unable to induce caspase-9 activity, indicating that it is not a major determinant in blocking caspase-9 in NSCLC cells.
17285546 Study confirms the association between CASP9 gene and non-small cell lung cancer oncogenesis, rs1052576 which locates in exon 5 of CASP9 gene is associated with NSCLC.
17285546 Observational study of gene-disease association. (HuGE Navigator)
17140287 HIV-1 protease directly cleaves and activates procaspase 8 in T cells which is associated with cleavage of BID, mitochondrial release of cytochrome c, activation of the downstream caspases 9 and 3, and cleavage of DFF and PARP
17079734 Caspase-9 is not only required for DeltaPsi(M) loss but also for caspase-2 activation, suggesting that these two events are downstream of the apoptosome
17071630 Observational study of gene-disease association. (HuGE Navigator)
17030903 BMPs promote apoptotic cell death in normal human pulmonary artery smooth muscle cells (PASMCs) by activation of caspases-3, -8, and -9, cytochrome c release, and downregulation of Bcl-2
16895904 Caspase-9-deficient cells reveal strongly impaired apoptosis, caspase activation, and mitochondrial membrane depolarization upon CD95 triggering.
16780893 A novel human caspase-9 splice variant containing only the CARD domain was cloned.
16716256 caspase-3 and caspase-9 activation has critical roles in hypoxia/reoxygenation induced apoptosis
16689829 These data indicate that the caspase-9 gene is rarely mutated in gastric, colorectal and lung adenocarcinomas, and suggest that caspase-9 gene mutation may not contribute to the pathogenesis of these cancers.
16687442 Observational study of gene-disease association. (HuGE Navigator)
16687442 Results suggest that CASP-9 promoter polymorphisms affect CASP-9 expression and contribute to genetic susceptibility to lung cancer.
16520893 HIV-1 protease directly cleaves and activates procaspase 8 in T cells which is associated with cleavage of BID, mitochondrial release of cytochrome c, activation of the downstream caspases 9 and 3, and cleavage of DFF and PARP
16511342 HIV-1 protease directly cleaves and activates procaspase 8 in T cells which is associated with cleavage of BID, mitochondrial release of cytochrome c, activation of the downstream caspases 9 and 3, and cleavage of DFF and PARP
16505493 identified SRp30a as an RNA trans-acting factor that functions as a major regulator of caspase-9 pre-mRNA processing and is required for ceramide to mediate the alternative splicing of caspase-9
16505307 Blood values increased in untreated Parkinson disease patientes.
16480911 HIV-1 protease directly cleaves and activates procaspase 8 in T cells which is associated with cleavage of BID, mitochondrial release of cytochrome c, activation of the downstream caspases 9 and 3, and cleavage of DFF and PARP
16337360 These results provide evidence for a novel type 1 IFN-mediated pathway that regulates apoptosis of T cells through a mitochondrial-dependent and caspase-dependent and independent pathway.
16300929 Thrombin is able to induce activation of caspases 3 and 9 in human platelets and significantly increases the amount in the cytoskeleton of the active forms of both caspases and the procaspases 3 and 9.
16287866 caspase 9 acts as a focal point for multiple protein kinase signaling pathways that regulate apoptosis
16260615 TGF-beta is involved in the physiological loss of gastric epithelial cells by activating apoptosis mediated by Smad7, Bim, and caspase-9
16242324 caspase-3, -8, and -9 activity is enhanced by safrole oxidase in lung cancer cells
16181301 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16120388 HIV-1 protease directly cleaves and activates procaspase 8 in T cells which is associated with cleavage of BID, mitochondrial release of cytochrome c, activation of the downstream caspases 9 and 3, and cleavage of DFF and PARP
16038259 Observational study of gene-disease association. (HuGE Navigator)
15935070 the antiapoptotic property of Hualpha-Syn in neuronal cell lines is associated with the attenuation of caspase-3 activity without affecting the caspase-9 activity
15811855 OGG1 targeted to mitochondria reduces the activation of caspase-9
15767427 HIV-1 protease directly cleaves and activates procaspase 8 in T cells which is associated with cleavage of BID, mitochondrial release of cytochrome c, activation of the downstream caspases 9 and 3, and cleavage of DFF and PARP
15725353 HIV-1 protease directly cleaves and activates procaspase 8 in T cells which is associated with cleavage of BID, mitochondrial release of cytochrome c, activation of the downstream caspases 9 and 3, and cleavage of DFF and PARP
15703181 Protein kinase A regulates caspase-9 activation by Apaf-1 downstream of cytochrome c
15674327 Role for caspase-9 mediated cleavage of Raf-1 in the negative feedback regulation of hematopoietic cell apoptosis induced by growth factor withdrawal.
15657349 Gossypol induced complete cytochrome c release from mitochondria amd increased caspases-3 and -9 activity in large cell lymphoma cells.
15657060 caspase-9 autoprocessing is regulated by c-Abl in the apoptotic response to genotoxic stress.
15629764 Dopamine[DA] neurons were labeled and transduced with dominant negative Casp9. Progressive DA neuron lesion was induced by striatal 6-OHDA injection.Inhibiting apoptosis at caspase-9 is protective in vitro, but not in vivo.
15578977 HIV-1 protease directly cleaves and activates procaspase 8 in T cells which is associated with cleavage of BID, mitochondrial release of cytochrome c, activation of the downstream caspases 9 and 3, and cleavage of DFF and PARP
15485396 results suggest that ML-IAP might regulate apoptosis by sequestering Smac and preventing it from antagonizing XIAP-mediated inhibition of caspases, rather than by direct inhibition of caspases
15485395 ILP2 is an unstable protein, and cannot inhibit caspase 9 in a physiological way on its own; possibly ILP2 requires assistance from unidentified cellular factors to be an effective inhibitor of apoptosis in vivo
15473998 These data suggest that increased proneness to caspase activation in lymphocytes could reflect an ongoing systemic response in neurodegenerative disease with pathogenetic implications.
15300255 Apollon binds to, ubiquitinates and facilitates proteasomal degradation of SMAC and caspase-9, results suggesting that Apollon has an essential function in preventing SMAC-induced apoptosis
15280366 caspase-9 binds to NAIP in an ATP-dependent manner
15273730 Low-dose 5-aza-2'-deoxycytidine (DAC) induced enhancement of apoptosis mediated by Adenovirus-p53 infection, and ectopic overexpression of procaspase-9.
15220451 required for Parvovirus B19 virus-induced apoptosis in primary hepatocytes and hepatocellular carcinoma cell line HepG2
15214043 BCR-signal causes Bax translocation, followed by mitochondrial depolarization, and cytC release; subsequent caspase-9 activation can account for events further downstream
14993223 the functional apoptosome complex in apoptotic cells consists primarily of Apaf-1 and processed caspase-9
14991812 caspase-9 activation in human disease can play a prominent role in localized cellular degenerative processes without causing nuclear or cell death.
14982875 RGDS directly binds and activates caspases 8 and 9, inhibits chemotaxis, and induces apoptosis of HUVECs with a mechanism independent from its antiadhesive effect.
14747474 procaspase-9 is dimerized and processed by redox stress in mitochondria
14701803 S-nitrosation regulates activation of endogenous procaspase-9 in HT-29 cells
14684629 Caspase-9 is activated in oxidized low-density lipoprotein (ox-LDL) induces apoptosis in endothelial cells.
14566819 AMF regulates expression of Apaf-1 and caspase-9 genes via a complex signaling pathway and indirectly regulates formation of the apoptosome.
12954616 caspase 9 is not critical for ultraviolet ray-induced apoptosis in tumor cells
12914932 caspase-9 is activated by reactive oxygen species (ROS) without involvement of cytochrome c release in hypoxic injury
12804035 CASP 9 by itself can activate caspase 7 in the absence of the caspase 3-dependent pathway in TNF-alpha-induced apoptosis
12782307 caspase-9 redistribution is a regulated process and requires the activity of a caspase other than the caspase-9- this is required to control the activity of caspase-9
12749848 Smac-induced apoptosis proceeds via a pathway mediated by caspase-9 that can be inhibited by zLEHD-fmk and overexpression of XIAP protein.
12732844 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
12637514 aggregation of multiple procaspase-9 molecules can induce their activation independent of the apoptosome
12620239 single amino acid substitutions at the dimer interface abrogate the activity of caspases-8 and -9
12566444 Presentation of nitric oxide regulates monocyte survival through effects on this enzyme and caspase-3 activation.
12404116 HIV-1 protease directly cleaves and activates procaspase 8 in T cells which is associated with cleavage of BID, mitochondrial release of cytochrome c, activation of the downstream caspases 9 and 3, and cleavage of DFF and PARP
12393884 blocks apocytochrome c activation and Bax-induced apoptosis
12393263 Data suggest that the expression levels of caspase 9 or caspase 9S do not play a major role in determining vulnerability to apoptosis in human astrocytoma cells.
12372609 processing and activation upon dsRNA-dependent protein kinase expression
12145703 Pro-CASP9 moved from the nucleus to the mitochondria of U937 cells during TPA-induced differentiation.
12096338 Adenovirus encoding HIV-1 Vpr activates caspase 9 and induces apoptotic cell death in both p53 positive and negative human tumor cell lines.
12096338 HIV-1 protease directly cleaves and activates procaspase 8 in T cells which is associated with cleavage of BID, mitochondrial release of cytochrome c, activation of the downstream caspases 9 and 3, and cleavage of DFF and PARP
12095993 HIV-1 protease directly cleaves and activates procaspase 8 in T cells which is associated with cleavage of BID, mitochondrial release of cytochrome c, activation of the downstream caspases 9 and 3, and cleavage of DFF and PARP
12055227 Down-regulation of caspase-9 is involved during serum-factor dependent phagocytosis of platelets by monocytes.
12021264 activation by an alternative mechanism virally infected cells beside the well characterized pathways via death receptors or mitochondrial cytochrome c release
11919192 Activation of caspase-9 is required for UV-induced apoptosis of human keratinocytes
11905052 inhibition of caspase-9 activity represents another mechanism of acquired cisplatin resistance
11870543 Caspase-9 at chromosome 1 reveal rare allelic variants in neuroblastoma tumors
11801602 regulation of alternative splicing in lung adenocarcinoma cells by de novo ceramide
11462036 HIV-1 protease directly cleaves and activates procaspase 8 in T cells which is associated with cleavage of BID, mitochondrial release of cytochrome c, activation of the downstream caspases 9 and 3, and cleavage of DFF and PARP
10708425 HIV-1 protease directly cleaves and activates procaspase 8 in T cells which is associated with cleavage of BID, mitochondrial release of cytochrome c, activation of the downstream caspases 9 and 3, and cleavage of DFF and PARP
10438581 HIV-1 protease directly cleaves and activates procaspase 8 in T cells which is associated with cleavage of BID, mitochondrial release of cytochrome c, activation of the downstream caspases 9 and 3, and cleavage of DFF and PARP

AA Sequence

MDEADRRLLRRCRLRLVEELQVDQLWDALLSRELFRPHMIEDIQRAGSGSRRDQARQLIIDLETRGSQAL      1 - 70
PLFISCLEDTGQDMLASFLRTNRQAAKLSKPTLENLTPVVLRPEIRKPEVLRPETPRPVDIGSGGFGDVG     71 - 140
ALESLRGNADLAYILSMEPCGHCLIINNVNFCRESGLRTRTGSNIDCEKLRRRFSSLHFMVEVKGDLTAK    141 - 210
KMVLALLELAQQDHGALDCCVVVILSHGCQASHLQFPGAVYGTDGCPVSVEKIVNIFNGTSCPSLGGKPK    211 - 280
LFFIQACGGEQKDHGFEVASTSPEDESPGSNPEPDATPFQEGLRTFDQLDAISSLPTPSDIFVSYSTFPG    281 - 350
FVSWRDPKSGSWYVETLDDIFEQWAHSEDLQSLLLRVANAVSVKGIYKQMPGCFNFLRKKLFFKTS        351 - 416
//

Text Mined References (306)

PMID Year Title
27141571 Immunohistochemical Aspects of Cell Death in Diabetic Nephropathy.
27107012 2016 Pooled-matrix protein interaction screens using Barcode Fusion Genetics.
26323553 2015 HAX-1 inhibits apoptosis in prostate cancer through the suppression of caspase-9 activation.
26290316 2015 An epistatic effect of apaf-1 and caspase-9 on chlamydial infection.
26024713 2015 Recombinant Multivalent EMMPRIN Extracellular Domain Induces U937 Human Leukemia Cell Apoptosis by Downregulation of Monocarboxylate Transporter 1 and Activation of Procaspase-9.
26014377 2015 Inhibition of Myeloid Cell Leukemia 1 and Activation of Caspases Are Critically Involved in Gallotannin-induced Apoptosis in Prostate Cancer Cells.
25815518 2015 Synergistic effects of valproic acid and arsenic trioxide on RPMI8226 cells in vitro and the possible underlying mechanisms.
25665064 2015 Silver nanoparticles biosynthesized using Achillea biebersteinii flower extract: apoptosis induction in MCF-7 cells via caspase activation and regulation of Bax and Bcl-2 gene expression.
25569260 2015 A mutation in caspase-9 decreases the expression of BAFFR and ICOS in patients with immunodeficiency and lymphoproliferation.
25416956 2014 A proteome-scale map of the human interactome network.
25370148 2014 Investigation of the caspase-dependent mitochondrial apoptotic pathway in mononuclear cells of patients with systemic Lupus erythematosus.
25356864 2014 Caspase-9 mediates Puma activation in UCN-01-induced apoptosis.
25330190 2014 Transcriptomic analysis unveils correlations between regulative apoptotic caspases and genes of cholesterol homeostasis in human brain.
25241761 2014 Using an in situ proximity ligation assay to systematically profile endogenous protein-protein interactions in a pathway network.
25214386 2011 Artemisinin induces caspase-8/9-mediated and Bax/Bak-independent apoptosis in human lung adenocarcinoma (ASTC-a-1) cells.
25059065 2014 [Soluble apoptosis markers in obese patients with food intolerance].
25031754 2014 Phosphorylation status of Akt and caspase-9 in gastric and colorectal carcinomas.
24980229 Expression of apoptosis mediators p53 and caspase 3, 7, and 9 in chronic rhinosinusitis with nasal polyposis.
24879622 2014 Association of caspase9 promoter polymorphisms with the susceptibility of AML in south Indian subjects.
24839934 2014 PinX1 without the G-patch motif suppresses proliferation, induces senescence, but does not inhibit telomerase activity in colorectal cancer SW480 cells.
24661197 2014 Silica and double-stranded RNA synergistically induce bronchial epithelial apoptosis and airway inflammation.
24592539 2013 Apoptotic block in colon cancer cells may be rectified by lentivirus mediated overexpression of caspase-9.
24530529 2014 ATM kinase promotes both caspase-8 and caspase-9 activation during TNF-?-induced apoptosis of HeLa cells.
24427328 2014 KAT5 silencing induces apoptosis of GBC-SD cells through p38MAPK-mediated upregulation of cleaved Casp9.
24424093 2014 Amyloid ? binds procaspase-9 to inhibit assembly of Apaf-1 apoptosome and intrinsic apoptosis pathway.
24405603 2014 [Expressions and clinical significances of iASPP and caspase-9 in esophageal cancer].
24377517 2013 Induction of caspase-9, biochemical assessment and morphological changes caused by apoptosis in cancer cells treated with goniothalamin extracted from Goniothalamus macrophyllus.
24362031 2014 A Complex between Atg7 and Caspase-9: A NOVEL MECHANISM OF CROSS-REGULATION BETWEEN AUTOPHAGY AND APOPTOSIS.
24346702 2014 Cas9 effector-mediated regulation of transcription and differentiation in human pluripotent stem cells.
24161344 2013 A novel synthetic analog of Militarin, MA-1 induces mitochondrial dependent apoptosis by ROS generation in human lung cancer cells.
23867824 2013 Role of cathepsin B in dengue virus-mediated apoptosis.
23725396 2013 Analysis of association between IL-1?, CASP-9, and GDF5 variants and low-back pain in Chinese male soldier: clinical article.
23652278 2013 OSU-03012, a non-Cox inhibiting celecoxib derivative, induces apoptosis of human esophageal carcinoma cells through a p53/Bax/cytochrome c/caspase-9-dependent pathway.
23645041 2013 Influence of survivin (BIRC5) and caspase-9 (CASP9) functional polymorphisms in renal cell carcinoma development: a study in a southern European population.
23637769 2013 Specific targeting of caspase-9/PP2A interaction as potential new anti-cancer therapy.
23615977 2013 Epigallocatechin-3-gallate promotes apoptosis and expression of the caspase 9a splice variant in PC3 prostate cancer cells.
23572523 2013 Proteolytic processing of the caspase-9 zymogen is required for apoptosome-mediated activation of caspase-9.
23566959 2013 p53 activation by Ni(II) is a HIF-1? independent response causing caspases 9/3-mediated apoptosis in human lung cells.
23539542 2012 Promotion of Caspase Activation by Caspase-9-mediated Feedback Amplification of Mitochondrial Damage.
23516580 2013 The E. coli effector protein NleF is a caspase inhibitor.
23479167 2013 CASP-9 gene functional polymorphisms and cancer risk: a large-scale association study plus meta-analysis.
23443079 2012 Ginsenoside Rh2 induces human hepatoma cell apoptosisvia bax/bak triggered cytochrome C release and caspase-9/caspase-8 activation.
23430060 2013 Induction of apoptosis through caspase-independent or caspase-9-dependent pathway in mouse and human osteosarcoma cells by a new nitroxyl spin-labeled derivative of podophyllotoxin.
23424205 2013 Effects of ?-glucan extracted from Agaricus blazei on the expression of ERCC5, CASP9, and CYP1A1 genes and metabolic profile in HepG2 cells.
23396972 2013 hnRNP U enhances caspase-9 splicing and is modulated by AKT-dependent phosphorylation of hnRNP L.
23359247 2013 Caspase signalling pathways in human spermatogenesis.
23303631 2013 Association of CASP9, CASP10 gene polymorphisms and tea drinking with colorectal cancer risk in the Han Chinese population.
23203690 2012 Inhibition of caspase-9 by stabilized peptides targeting the dimerization interface.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23109891 2012 Ethyl gallate induces apoptosis of HL-60 cells by promoting the expression of caspases-8, -9, -3, apoptosis-inducing factor and endonuclease G.
23038270 2012 Systems analysis of cancer cell heterogeneity in caspase-dependent apoptosis subsequent to mitochondrial outer membrane permeabilization.
22981751 2012 Caspase 9 promoter polymorphisms confer increased susceptibility to breast cancer.
22974165 2012 Expression of c-Jun, p73, Casp9, and N-ras in thymic epithelial tumors: relationship with the current WHO classification systems.
22944165 2012 [Atorvastatin inhibits the H?O?-induced apoptosis of human vascular endothelial cells through a down-regulation of cleaved caspase-9/caspase-3].
22926545 2013 Daidzein induced apoptosis via down-regulation of Bcl-2/Bax and triggering of the mitochondrial pathway in BGC-823 cells.
22683311 2012 Interaction of CSR1 with XIAP reverses inhibition of caspases and accelerates cell death.
22679284 2012 Patched dependence receptor triggers apoptosis through ubiquitination of caspase-9.
22616010 2012 A meta-analysis of caspase 9 polymorphisms in promoter and exon sequence on cancer susceptibility.
22573662 2012 Mechanism of zinc-mediated inhibition of caspase-9.
22339913 2011 [Studies on apoptosis and caspase-8 and caspase-9 expressions of bone marrow cells in chronic mountain sickness].
22306364 2012 Ordering of ceramide formation and caspase-9 activation in CD95L-induced Jurkat leukemia T cell apoptosis.
22191568 2012 Bromelain-induced apoptosis in GI-101A breast cancer cells.
22120515 2012 Role of Caspase 8, Caspase 9 and Bcl-2 polymorphisms in papillary thyroid carcinoma risk in Han Chinese population.
22086301 2012 Protective effects of olive oil phenolics and gallic acid on hydrogen peroxide-induced apoptosis.
21988832 2011 Toward an understanding of the protein interaction network of the human liver.
21957492 2011 Role of caspase 9 in activation of HTLV-1 LTR expression by DNA damaging agents.
21944661 2011 Small molecular anticancer agent SKLB703 induces apoptosis in human hepatocellular carcinoma cells via the mitochondrial apoptotic pathway invitro and inhibits tumor growth invivo.
21869827 2012 The IAP-antagonist ARTS initiates caspase activation upstream of cytochrome C and SMAC/Diablo.
21868008 2011 Sperm caspase-9 in oligoasthenoteratozoospermic men with and without varicocele.
21827945 2011 The holo-apoptosome: activation of procaspase-9 and interactions with caspase-3.
21785112 2011 The mechanism of neogambogic acid-induced apoptosis in human MCF-7 cells.
21757755 2011 Structural determinants of caspase-9 inhibition by the vaccinia virus protein, F1L.
21724551 2011 In vitro and in vivo selective antitumor activity of a novel orally bioavailable proteasome inhibitor MLN9708 against multiple myeloma cells.
21659556 2011 Triggering of a novel intrinsic apoptosis pathway by the kinase inhibitor staurosporine: activation of caspase-9 in the absence of Apaf-1.
21644232 2011 [Association of CASP3 and CASP9 polymorphisms with genetic susceptibility to stomach cancer].
21622622 2011 SRSF1 regulates the alternative splicing of caspase 9 via a novel intronic splicing enhancer affecting the chemotherapeutic sensitivity of non-small cell lung cancer cells.
21612408 2011 Essential role for p53 and caspase-9 in DNA damaging drug-induced apoptosis in neuroblastoma IMR32 cells.
21565459 2011 Concomitant activation of caspase-9 and down-regulation of IAP proteins as a mechanism of apoptotic death in HepG2, T47D and HCT-116 cells upon exposure to a derivative from 4-aryl-4H-chromenes family.
21555338 2011 Mechanism of pyrethroid pesticide-induced apoptosis: role of calpain and the ER stress pathway.
21538054 2011 Polymorphisms of caspase 8 and caspase 9 gene and colorectal cancer susceptibility and prognosis.
21461653 2011 Caspase 8 and caspase 9 gene polymorphisms and susceptibility to gastric cancer.
21396853 Polymorphisms and haplotypes in caspases 8 and 9 genes and risk for prostate cancer: a case-control study in cohort of North India.
21382445 2011 Agaritine from Agaricus blazei Murrill induces apoptosis in the leukemic cell line U937.
21297999 2011 Defective molecular timer in the absence of nucleotides leads to inefficient caspase activation.
21284734 2011 Immune clearance gastric carcinoma cells in ascites by activating caspase-9-induced apoptosis.
21282934 2011 Caspase-4 directly activates caspase-9 in endoplasmic reticulum stress-induced apoptosis in SH-SY5Y cells.
21266831 2010 Caspase-9-dependent nuclear translocation of cytochrome c in hypoxic injury.
21178828 2011 Apoptosis in the sequestrated nucleus pulposus compared to the remaining nucleus pulposus in the same patient.
21142842 2011 Cationic nanoparticles induce caspase 3-, 7- and 9-mediated cytotoxicity in a human astrocytoma cell line.
21117896 2011 Caspase 9 gene polymorphism and susceptibility to lumbar disc disease in the Han population in northern China.
21091209 2011 Association between Caspase-9 promoter region polymorphisms and discogenic low back pain.
21048031 2011 Single nucleotide polymorphisms of matrix metalloproteinase 9 (MMP9) and tumor protein 73 (TP73) interact with Epstein-Barr virus in chronic lymphocytic leukemia: results from the European case-control study EpiLymph.
21045158 2010 Alternative splicing of caspase 9 is modulated by the phosphoinositide 3-kinase/Akt pathway via phosphorylation of SRp30a.
20978129 2010 Activation of caspase-9, but not caspase-2 or caspase-8, is essential for heat-induced apoptosis in Jurkat cells.
20959405 2010 The IFNG (IFN-gamma) genotype predicts cytogenetic and molecular response to imatinib therapy in chronic myeloid leukemia.
20887385 2011 Association of caspase-9 and RUNX3 with inflammatory bowel disease.
20855536 2010 Germline variation in apoptosis pathway genes and risk of non-Hodgkin's lymphoma.
20804486 2011 Influence of caspases 8 and 9 gene promoter polymorphism on prostate cancer susceptibility and early development of hormone refractory prostate cancer.
20800603 2010 Investigation of genetic susceptibility factors for human longevity - a targeted nonsynonymous SNP study.
20667824 2010 cIAP1 cooperatively inhibits procaspase-3 activation by the caspase-9 apoptosome.
20663920 2010 Identification and characterization of GRIM-1, a cell-death-associated gene product.
20661084 2010 Polymorphisms in the caspase genes and the risk of lung cancer.
20650551 2010 Fat intake interacts with polymorphisms of Caspase9, FasLigand and PPARgamma apoptotic genes in modulating Crohn's disease activity.
20644561 2011 A large-scale candidate gene approach identifies SNPs in SOD2 and IL13 as predictive markers of response to preoperative chemoradiation in rectal cancer.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20490276 2010 Insulin promotes survival of amyloid-beta oligomers neuroblastoma damaged cells via caspase 9 inhibition and Hsp70 upregulation.
20453000 2010 A Large-scale genetic association study of esophageal adenocarcinoma risk.
20402676 2010 Mutational analysis of caspase genes in prostate carcinomas.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20357690 2010 Effects of caspase-9 and survivin gene polymorphisms in pancreatic cancer risk and tumor characteristics.
20227384 Nitration of tyrosine 74 prevents human cytochrome c to play a key role in apoptosis signaling by blocking caspase-9 activation.
20227371 2010 tRNA binds to cytochrome c and inhibits caspase activation.
20071584 2010 Caspase 9 is essential for herpes simplex virus type 2-induced apoptosis in T cells.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
20060927 2011 Exacerbation of tobacco smoke mediated apoptosis by resveratrol: an unexpected consequence of its antioxidant action.
20042134 2009 [Effect of erythropoietin on the caspase-3 subfamily in preventing apoptosis of endothelial cell].
20022954 2010 Vaccinia virus protein F1L is a caspase-9 inhibitor.
20013803 2010 Expression and prognostic significance of APAF-1, caspase-8 and caspase-9 in stage II/III colon carcinoma: caspase-8 and caspase-9 is associated with poor prognosis.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19906200 2009 Feedback regulation of mitochondria by caspase-9 in the B cell receptor-mediated apoptosis.
19826114 2009 Polymorphisms in the CASPASE genes and survival in patients with early-stage non-small-cell lung cancer.
19807657 2009 FoxO3a governs early microglial proliferation and employs mitochondrial depolarization with caspase 3, 8, and 9 cleavage during oxidant induced apoptosis.
19789190 2009 A gene-based risk score for lung cancer susceptibility in smokers and ex-smokers.
19773279 2009 Association between genetic variants in VEGF, ERCC3 and occupational benzene haematotoxicity.
19770581 2009 Green tea (-)-epigalocatechin-3-gallate inhibits KIT activity and causes caspase-dependent cell death in gastrointestinal stromal tumor including imatinib-resistant cells.
19758996 2009 Caspase-9 activation by the apoptosome is not required for fas-mediated apoptosis in type II Jurkat cells.
19741144 2009 Caspase-9 activation revealed by semaphorin 7A cleavage is independent of apoptosis in the aged olfactory bulb.
19724860 2009 Potential role of Notch1 signaling pathway in laryngeal squamous cell carcinoma cell line Hep-2 involving proliferation inhibition, cell cycle arrest, cell apoptosis, and cell migration.
19692168 2010 Genetic susceptibility to distinct bladder cancer subphenotypes.
19655415 2009 Protective effect of magnolol against hydrogen peroxide-induced oxidative stress in human lens epithelial cells.
19626422 2010 Caspase-3 and -9 are activated in human myeloid HL-60 cells by calcium signal.
19625176 2009 PTEN identified as important risk factor of chronic obstructive pulmonary disease.
19573080 2009 Common genetic variants in candidate genes and risk of familial lymphoid malignancies.
19550122 2009 Caspase-dependent molecular mechanisms of anti-human DR5 monoclonal antibody mDRA-6 inducing apoptosis of human leukemia Jurkat cells.
19494828 2009 The Apaf-1*procaspase-9 apoptosome complex functions as a proteolytic-based molecular timer.
19493480 2009 [Changes of caspase-8 and caspase-9 activity during apoptosis of keratinocytes induced by trichloroethylene].
19465923 2009 The Patched dependence receptor triggers apoptosis through a DRAL-caspase-9 complex.
19414860 2009 Genetic variation in caspase genes and risk of non-Hodgkin lymphoma: a pooled analysis of 3 population-based case-control studies.
19412632 2009 Caspase 9 and caspase 8 gene polymorphisms and susceptibility to bladder cancer in north Indian population.
19359048 2009 CASP-9: A susceptibility locus for multiple sclerosis in Italy.
19269008 2009 Mutational analysis of CASP1, 2, 3, 4, 5, 6, 7, 8, 9, 10, and 14 genes in gastrointestinal stromal tumors.
19255499 2009 HIP1R interacts with a member of Bcl-2 family, BCL2L10, and induces BAK-dependent cell death.
19238172 2009 Oxidative modification of caspase-9 facilitates its activation via disulfide-mediated interaction with Apaf-1.
19219602 2009 Prostaglandin synthase 2/cyclooxygenase 2 (PTGS2/COX2) 8473T>C polymorphism associated with prognosis for patients with colorectal cancer treated with capecitabine and oxaliplatin.
19183163 2009 Infliximab dependency in children with Crohn's disease.
19170196 2009 Polymorphisms in innate immunity genes and lung cancer risk in Xuanwei, China.
19159073 2009 Extracellular adenosine induces apoptosis in Caco-2 human colonic cancer cells by activating caspase-9/-3 via A(2a) adenosine receptors.
19153467 2009 The structure of the BIR3 domain of cIAP1 in complex with the N-terminal peptides of SMAC and caspase-9.
19141860 2009 Genetic variants in the candidate genes of the apoptosis pathway and susceptibility to chronic myeloid leukemia.
19118655 2009 Comparative proteomics analysis of caspase-9-protein complexes in untreated and cytochrome c/dATP stimulated lysates of NSCLC cells.
19081073 2008 The protein kinase DYRK1A regulates caspase-9-mediated apoptosis during retina development.
19074885 2008 Genetic variants in apoptosis and immunoregulation-related genes are associated with risk of chronic lymphocytic leukemia.
19058789 2009 A common variant in DRD3 receptor is associated with autism spectrum disorder.
19052714 2009 TP53 codon 72 polymorphism associated with prognosis in patients with advanced gastric cancer treated with paclitaxel and cisplatin.
19016842 2008 DYRK1A phosphorylates caspase 9 at an inhibitory site and is potently inhibited in human cells by harmine.
18840411 2008 c-FLIP knockdown induces ligand-independent DR5-, FADD-, caspase-8-, and caspase-9-dependent apoptosis in breast cancer cells.
18814044 2008 Immunohistochemical localization of caspase-3, caspase-9 and Bax in U87 glioblastoma xenografts.
18813792 2008 Simultaneous downregulation of uPAR and MMP-9 induces overexpression of the FADD-associated protein RIP and activates caspase 9-mediated apoptosis in gliomas.
18723680 2008 Executioner caspase-3 and caspase-7 are functionally distinct proteases.
18676680 2008 Pathway-based evaluation of 380 candidate genes and lung cancer susceptibility suggests the importance of the cell cycle pathway.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18632964 2008 Japanese encephalitis virus infection activates caspase-8 and -9 in a FADD-independent and mitochondrion-dependent manner.
18415681 2008 Role of Bcl-2 family members in caspase-3/9-dependent apoptosis during Pseudomonas aeruginosa infection in U937 cells.
18381704 2008 Caspase polymorphisms and genetic susceptibility to multiple myeloma.
18309324 2008 No death without life: vital functions of apoptotic effectors.
18297401 2008 Bid truncation mediated by caspases-3 and -9 in vinorelbine-induced apoptosis.
18202770 2008 Caspase-9 pathway activation by inhibiting endogenous fibroblast growth factor signaling in human glioma cells.
18086147 2008 Melatonin maintains mitochondrial membrane potential and attenuates activation of initiator (casp-9) and effector caspases (casp-3/casp-7) and PARP in UVR-exposed HaCaT keratinocytes.
18083711 2008 The docking interaction of caspase-9 with ERK2 provides a mechanism for the selective inhibitory phosphorylation of caspase-9 at threonine 125.
18054197 2008 Caspases-3, -8, and -9 are required for induction of epithelial cell apoptosis by enteropathogenic E. coli but are dispensable for increased paracellular permeability.
18022362 2007 IAP antagonists induce autoubiquitination of c-IAPs, NF-kappaB activation, and TNFalpha-dependent apoptosis.
17899380 2008 Delineation of the caspase-9 signaling cascade.
17893147 2007 Caspase-9-induced mitochondrial disruption through cleavage of anti-apoptotic BCL-2 family members.
17626072 2007 Bortezomib induces apoptosis of Epstein-Barr virus (EBV)-transformed B cells and prolongs survival of mice inoculated with EBV-transformed B cells.
17534194 2007 Apoptotic gene analysis in idiopathic talipes equinovarus (clubfoot).
17466630 2007 Phosphorylation of caspase-9 by CDK1/cyclin B1 protects mitotic cells against apoptosis.
17437405 2007 Caspase 3 attenuates XIAP (X-linked inhibitor of apoptosis protein)-mediated inhibition of caspase 9.
17379327 2007 Polycomb group protein RING1B is a direct substrate of Caspases-3 and -9.
17299206 2006 Resveratrol-induced cell inhibition of growth and apoptosis in MCF7 human breast cancer cells are associated with modulation of phosphorylated Akt and caspase-9.
17291493 2007 Role of XIAP in inhibiting cisplatin-induced caspase activation in non-small cell lung cancer cells: a small molecule Smac mimic sensitizes for chemotherapy-induced apoptosis by enhancing caspase-3 activation.
17285546 2007 [A study on the expression of CASP9 gene and its polymorphism distribution in non-small cell lung cancer].
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
17167422 2007 Hsp70 regulates erythropoiesis by preventing caspase-3-mediated cleavage of GATA-1.
17079734 2007 Loss of caspase-9 reveals its essential role for caspase-2 activation and mitochondrial membrane depolarization.
17071630 2007 Genetic variants in caspase genes and susceptibility to non-Hodgkin lymphoma.
17030903 2006 BMP-dependent activation of caspase-9 and caspase-8 mediates apoptosis in pulmonary artery smooth muscle cells.
16936772 2007 Integrin-linked kinase interacts with caspase-9 and -8 in an adhesion-dependent manner for promoting radiation-induced apoptosis in human leukemia cells.
16895904 2006 Loss of caspase-9 provides genetic evidence for the type I/II concept of CD95-mediated apoptosis.
16857965 2006 Overexpression of HAX-1 protects cardiac myocytes from apoptosis through caspase-9 inhibition.
16780893 2006 Cloning of a novel human caspase-9 splice variant containing only the CARD domain.
16716256 2006 The critical role of caspases activation in hypoxia/reoxygenation induced apoptosis.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16689829 2006 Mutational analysis of proapoptotic caspase-9 gene in common human carcinomas.
16687442 2006 Caspase 9 promoter polymorphisms and risk of primary lung cancer.
16505493 2006 SRp30a (ASF/SF2) regulates the alternative splicing of caspase-9 pre-mRNA and is required for ceramide-responsiveness.
16505307 2006 Peripheral proteasome and caspase activity in Parkinson disease and Alzheimer disease.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16337360 2006 Type I interferons activate apoptosis in a Jurkat cell variant by caspase-dependent and independent mechanisms.
16300929 2006 Caspases 3 and 9 are translocated to the cytoskeleton and activated by thrombin in human platelets. Evidence for the involvement of PKC and the actin filament polymerization.
16287866 2005 Regulation of caspase 9 through phosphorylation by protein kinase C zeta in response to hyperosmotic stress.
16260615 2005 Transforming growth factor beta-dependent sequential activation of Smad, Bim, and caspase-9 mediates physiological apoptosis in gastric epithelial cells.
16242324 2006 Safrole oxide induces apoptosis by activating caspase-3, -8, and -9 in A549 human lung cancer cells.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
16181301 2005 Polymorphisms in apoptosis genes predict response to infliximab therapy in luminal and fistulizing Crohn's disease.
16038259 2005 [Screening susceptibility genes of type 2 diabetes in Chinese population by single nucleotide polymorphism analysis].
15935070 2005 Antiapoptotic property of human alpha-synuclein in neuronal cell lines is associated with the inhibition of caspase-3 but not caspase-9 activity.
15811855 2005 Cytokines induce nitric oxide-mediated mtDNA damage and apoptosis in oligodendrocytes. Protective role of targeting 8-oxoguanine glycosylase to mitochondria.
15735701 2005 Caspase-9 can antagonize p53-induced apoptosis by generating a p76(Rb) truncated form of Rb.
15703181 2005 Protein kinase A regulates caspase-9 activation by Apaf-1 downstream of cytochrome c.
15674327 2005 Apoptosis of hematopoietic cells induced by growth factor withdrawal is associated with caspase-9 mediated cleavage of Raf-1.
15657349 2005 Preclinical studies of a nonpeptidic small-molecule inhibitor of Bcl-2 and Bcl-X(L) [(-)-gossypol] against diffuse large cell lymphoma.
15657060 2005 c-Abl tyrosine kinase regulates caspase-9 autocleavage in the apoptotic response to DNA damage.
15629764 2005 A tetracycline-regulated adenovirus encoding dominant-negative caspase-9 is regulated in rat brain and protects against neurotoxin-induced cell death in vitro, but not in vivo.
15500642 2004 Plakin proteins are coordinately cleaved during apoptosis but preferentially through the action of different caspases.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15485396 2005 Engineering ML-IAP to produce an extraordinarily potent caspase 9 inhibitor: implications for Smac-dependent anti-apoptotic activity of ML-IAP.
15485395 2005 The BIR domain of IAP-like protein 2 is conformationally unstable: implications for caspase inhibition.
15473998 2004 Increased caspase activation in peripheral blood mononuclear cells of patients with Alzheimer's disease.
15300255 2004 Apollon ubiquitinates SMAC and caspase-9, and has an essential cytoprotection function.
15280366 2004 Neuronal apoptosis-inhibitory protein does not interact with Smac and requires ATP to bind caspase-9.
15273730 2004 5-aza-2'-deoxycytidine upregulates caspase-9 expression cooperating with p53-induced apoptosis in human lung cancer cells.
15220451 2004 Parvovirus B19-induced apoptosis of hepatocytes.
15214043 2004 Apoptosis via the B cell antigen receptor requires Bax translocation and involves mitochondrial depolarization, cytochrome C release, and caspase-9 activation.
15200957 2004 Dual role of BRUCE as an antiapoptotic IAP and a chimeric E2/E3 ubiquitin ligase.
14993223 2004 Pro-apoptotic proteins released from the mitochondria regulate the protein composition and caspase-processing activity of the native Apaf-1/caspase-9 apoptosome complex.
14991812 2004 Focal caspase activation underlies the endplate myopathy in slow-channel syndrome.
14982875 2004 RGDS peptide induces caspase 8 and caspase 9 activation in human endothelial cells.
14747474 2004 Dimerization and processing of procaspase-9 by redox stress in mitochondria.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14701803 2004 S-Nitrosation regulates the activation of endogenous procaspase-9 in HT-29 human colon carcinoma cells.
14684629 2004 Role of caspases in Ox-LDL-induced apoptotic cascade in human coronary artery endothelial cells.
14634335 1999 Identification of an alternative form of caspase-9 in human gastric cancer cell lines: a role of a caspase-9 variant in apoptosis resistance.
14566819 2003 Autocrine motility factor signaling induces tumor apoptotic resistance by regulations Apaf-1 and Caspase-9 apoptosome expression.
12954616 2003 UV-induced apoptosis is mediated independent of caspase-9 in MCF-7 cells: a model for cytochrome c resistance.
12914932 2003 ROS-dependent caspase-9 activation in hypoxic cell death.
12804035 2003 Analysis of a mitochondrial apoptotic pathway using Bid-targeted ribozymes in human MCF7 cells in the absence of a caspase-3-dependent pathway.
12792650 2003 Inhibition of caspase-9 through phosphorylation at Thr 125 by ERK MAPK.
12782307 2003 Apoptosis triggered redistribution of caspase-9 from cytoplasm to mitochondria.
12749848 2003 Expression of Smac/DIABLO in ovarian carcinoma cells induces apoptosis via a caspase-9-mediated pathway.
12732844 2003 A study to survey susceptible genetic factors responsible for troglitazone-associated hepatotoxicity in Japanese patients with type 2 diabetes mellitus.
12637514 2003 Oligomerization is a general mechanism for the activation of apoptosis initiator and inflammatory procaspases.
12620239 2003 A unified model for apical caspase activation.
12620238 2003 Mechanism of XIAP-mediated inhibition of caspase-9.
12586738 2003 The p54 cleaved form of the tyrosine kinase Lyn generated by caspases during BCR-induced cell death in B lymphoma acts as a negative regulator of apoptosis.
12566444 2003 Presentation of nitric oxide regulates monocyte survival through effects on caspase-9 and caspase-3 activation.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12393884 2002 Apocytochrome c blocks caspase-9 activation and Bax-induced apoptosis.
12393263 2002 The role of caspases 9 and 9-short (9S) in death ligand- and drug-induced apoptosis in human astrocytoma cells.
12372609 2002 Caspase 9 activation by the dsRNA-dependent protein kinase, PKR: molecular mechanism and relevance.
12147322 2002 N-methyl-D-aspartate receptor and L-type voltage-gated Ca(2+) channel antagonists suppress the release of cytochrome c and the expression of procaspase-3 in rat hippocampus after global brain ischemia.
12145703 2002 Intracellular redistribution of procaspases during TPA-induced differentiation of U937 human leukemic cells.
12096338 2002 Adenovirus encoding HIV-1 Vpr activates caspase 9 and induces apoptotic cell death in both p53 positive and negative human tumor cell lines.
12095993 2002 HIV-1 Vpr induces apoptosis through caspase 9 in T cells and peripheral blood mononuclear cells.
12055227 2002 Down-regulation of monocyte apoptosis by phagocytosis of platelets: involvement of a caspase-9, caspase-3, and heat shock protein 70-dependent pathway.
12021264 2002 Caspase-8 and Apaf-1-independent caspase-9 activation in Sendai virus-infected cells.
11948397 2002 Ganciclovir-induced apoptosis in HSV-1 thymidine kinase expressing cells: critical role of DNA breaks, Bcl-2 decline and caspase-9 activation.
11927604 2002 The anti-apoptotic activity of XIAP is retained upon mutation of both the caspase 3- and caspase 9-interacting sites.
11870543 2002 Analyses of apoptotic regulators CASP9 and DFFA at 1P36.2, reveal rare allele variants in human neuroblastoma tumours.
11803376 2002 Pre-processed caspase-9 contained in mitochondria participates in apoptosis.
11801603 2002 SMAC negatively regulates the anti-apoptotic activity of melanoma inhibitor of apoptosis (ML-IAP).
11801602 2002 De novo ceramide regulates the alternative splicing of caspase 9 and Bcl-x in A549 lung adenocarcinoma cells. Dependence on protein phosphatase-1.
11734640 2001 Dimer formation drives the activation of the cell death protease caspase 9.
11514563 2001 Identification of a caspase-9 substrate and detection of its cleavage in programmed cell death during mouse development.
11423904 2001 Caspase cleavage of vimentin disrupts intermediate filaments and promotes apoptosis.
11408476 2001 TUCAN, an antiapoptotic caspase-associated recruitment domain family protein overexpressed in cancer.
11393657 2001 Two novel single-nucleotide polymorphisms of the Caspase-9 (CASP9) gene in the Japanese population.
11390657 2001 Molecular cloning of ILP-2, a novel member of the inhibitor of apoptosis protein family.
11387340 2001 Serum response factor cleavage by caspases 3 and 7 linked to apoptosis in human BJAB cells.
11350957 2001 Characterization of a novel proapoptotic caspase-2- and caspase-9-binding protein.
11248093 2001 The dependence receptor DCC (deleted in colorectal cancer) defines an alternative mechanism for caspase activation.
11242052 2001 A conserved XIAP-interaction motif in caspase-9 and Smac/DIABLO regulates caspase activity and apoptosis.
11230124 2001 Recruitment, activation and retention of caspases-9 and -3 by Apaf-1 apoptosome and associated XIAP complexes.
11084335 2000 ML-IAP, a novel inhibitor of apoptosis that is preferentially expressed in human melanomas.
11076957 2001 Molecular cloning and characterization of DEFCAP-L and -S, two isoforms of a novel member of the mammalian Ced-4 family of apoptosis proteins.
11069302 2000 Regulation of apoptosis at cell division by p34cdc2 phosphorylation of survivin.
11024045 2001 Livin, a novel inhibitor of apoptosis protein family member.
10708425 2000 Human immunodeficiency virus type 1 vpr induces apoptosis through caspase activation.
10671558 2000 Direct cleavage by the calcium-activated protease calpain can lead to inactivation of caspases.
10469173 1999 Changes in nuclear morphology during apoptosis correlate with vimentin cleavage by different caspases located either upstream or downstream of Bcl-2 action.
10438581 1999 Roles of p53 and caspases in the induction of cell cycle arrest and apoptosis by HIV-1 vpr.
10384055 1999 Genomic organization of the human caspase-9 gene on Chromosome 1p36. 1-p36.3.
10376594 1999 Structural basis of procaspase-9 recruitment by the apoptotic protease-activating factor 1.
10329646 1999 Nod1, an Apaf-1-like activator of caspase-9 and nuclear factor-kappaB.
10206961 1999 An APAF-1.cytochrome c multimeric complex is a functional apoptosome that activates procaspase-9.
10187815 1999 mE10, a novel caspase recruitment domain-containing proapoptotic molecule.
10085063 1999 Caspase-9 can be activated without proteolytic processing.
10070954 1999 Identification of an endogenous dominant-negative short isoform of caspase-9 that can regulate apoptosis.
9990849 1999 IAP family proteins--suppressors of apoptosis.
9922454 1999 Ordering the cytochrome c-initiated caspase cascade: hierarchical activation of caspases-2, -3, -6, -7, -8, and -10 in a caspase-9-dependent manner.
9890966 1999 A caspase-9 variant missing the catalytic site is an endogenous inhibitor of apoptosis.
9878060 1999 Boo, a novel negative regulator of cell death, interacts with Apaf-1.
9837928 1998 WD-40 repeat region regulates Apaf-1 self-association and procaspase-9 activation.
9812896 1998 Regulation of cell death protease caspase-9 by phosphorylation.
9671712 1998 A cloning method for caspase substrates that uses the yeast two-hybrid system: cloning of the antiapoptotic gene gelsolin.
9651578 1998 Autoactivation of procaspase-9 by Apaf-1-mediated oligomerization.
9545235 1998 IAPs block apoptotic events induced by caspase-8 and cytochrome c by direct inhibition of distinct caspases.
9539746 1998 Bcl-XL interacts with Apaf-1 and inhibits Apaf-1-dependent caspase-9 activation.
9488720 1998 Caspase-9, Bcl-XL, and Apaf-1 form a ternary complex.
9390557 1997 Cytochrome c and dATP-dependent formation of Apaf-1/caspase-9 complex initiates an apoptotic protease cascade.
9337844 1997 Caspases: the executioners of apoptosis.
9323209 1997 Caspase-3-generated fragment of gelsolin: effector of morphological change in apoptosis.
8962078 1996 Molecular ordering of the Fas-apoptotic pathway: the Fas/APO-1 protease Mch5 is a CrmA-inhibitable protease that activates multiple Ced-3/ICE-like cysteine proteases.
8900201 1996 The Ced-3/interleukin 1beta converting enzyme-like homolog Mch6 and the lamin-cleaving enzyme Mch2alpha are substrates for the apoptotic mediator CPP32.
8663294 1996 ICE-LAP6, a novel member of the ICE/Ced-3 gene family, is activated by the cytotoxic T cell protease granzyme B.
7983002 1994 CPP32, a novel human apoptotic protein with homology to Caenorhabditis elegans cell death protein Ced-3 and mammalian interleukin-1 beta-converting enzyme.
1067155 1976 Reproducibility of response to a questionnaire on symptoms of masticatory dysfunction.