Property Summary

NCBI Gene PubMed Count 47
PubMed Score 0.00
PubTator Score 44.77

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Gene RIF (38)

PMID Text
25599959 Our results indicate that the APAF1, BAX, and FLASH genes not only harbor frameshift mutations but also demonstrate mutational ITH, which together might play a role in the tumorigenesis of CRC with MSI-H by affecting the apoptosis of cancer cells.
25530566 ARS2 and CASP8AP2 expressions can precisely predict high-risk of relapse and ALL prognosis.
25339177 The conserved C-terminal domain shared by FLASH, YARP, and Mute recognizes the C-terminal sequence of NPAT orthologues, thus acting as a signal targeting proteins to histone locus bodies.
25238250 FLASH is required for embryogenesis, but not for cell proliferation or differentiation in embryonic stem cells.
24941917 High-quality solution NMR structures of three homeodomains from human proteins ALX4, ZHX1 and CASP8AP2 were solved.
24397596 the predictive values regarding low expressions of H2AFZ and CASP8AP2 and high white blood cell count suggest that these features could help to identify more accurately patients at greater risk of relapse.
24162774 HIV-1 gp120 upregulates the expression of caspase 8 associated protein 2 (CASP8AP2) in human B cells
23953914 Hypermethylation of two CpG sites upstream of CASP8AP2 promoter influences gene expression and treatment outcome in childhood acute lymphoblastic leukemia.
23673342 Data suggest that SUMO targets FLASH for proteasome-dependent degradation, which is associated with recruitment of FLASH to PML bodies.
23071092 FLASH/Lsm11 complex bind a unique combination of polyadenylation factors
22595458 These data demonstrate that methylation within the Casp8AP2 promoter correlates with the development of drug resistance and might serve as a biomarker and treatment target for drug resistance in cancer cells.
22427918 FLASH knockdown in HT1080 mutant cells defective in p53 did not significantly accelerate Fas mediated apoptosis indicating that the effect was dependent on functional p53.
22216762 This study further defines the role CASP8AP2/FLASH plays in the regulating expression of the replication-dependent histones and shows that its LOF results in broad and reproducible effects on the transcriptome of colorectal cancer cells
21725362 Data show that show that the transcription factor p73 binds to Flice-Associated Huge Protein (FLASH) and is part of the complex that regulates histone gene transcription.
21696825 CASP8AP2 is a promising prognostic indicator in pediatric acute lymphoblastic leukemia.
21338522 PIAS1 is a common partner for two cancer-related nuclear factors, c-Myb and FLASH.
21245389 Critical residues in human FLASH and Lsm11 that are involved in the interaction between these two proteins, are identified.
20801175 HIV-1 gp120 upregulates the expression of caspase 8 associated protein 2 (CASP8AP2) in human B cells
20237496 Observational study of gene-disease association. (HuGE Navigator)
20109966 investigated the expression of three apoptosis related genes, BCL2L13, CASP8AP2, and Livin, as well as their prognostic significance, in a retrospective study of 90 pediatric ALL patients diagnosed between 1996 and 2007 in Taiwan
19854135 Human FLASH interacts with Lsm11 in vitro and stimulates 3' end processing of histone pre-mRNA in mammalian nuclear extracts.
19773279 Observational study of gene-disease association. (HuGE Navigator)
19615980 these results point to a complex involvement of sumoylation in modulating the function of FLASH.
19573080 Observational study of gene-disease association. (HuGE Navigator)
19546234 Results suggest that FLASH functions in S phase progression through interaction with ARS2.
19414860 Observational study of gene-disease association. (HuGE Navigator)
19406988 a deletion at 6q15-16.1 in 9 of 73 (12%) of the childhood T-ALL patients predicts poor early treatment response. This deletion includes the CASP8AP2 gene, whose expression is shown to be down-regulated.
18677100 Only the number of FLASH/NPAT histone gene locus bodies correlates with ploidy and only these organelles appear to be regulated during the cell cycle.
18408764 c-Myb cooperates with FLASH in foci associated with active RNA polymerase II, leading to enhancement of Myb-dependent gene activation.
18038312 Frameshift mutation in the polyadenine tracts in both FLASH and PTPN13 genes is rare in colorectal carcinomas. Both FLASH and PTPN13 mutations in the polyadenine tracts may not have a crucial role in the pathogenesis of colorectal carcinomas.
18038312 Observational study of genotype prevalence. (HuGE Navigator)
17696945 increased expression of FLASH in malignant gastric epithelial cells compared to the normal cells suggests that FLASH expression may play a role in gastric tumorigenesis; data suggest that somatic mutation of FLASH is a rare event in gastric carcinomas
17245429 CD95 signals are mediated by nucleo-cytoplasmic translocation of FLASH.
17003126 FLICE-associated huge protein (FLASH), originally described as a component of the apoptosis signaling pathway, is mainly localized in Cajal bodies and is essential for their structure.
17003125 These results identify FLASH as an important component of the machinery required for histone precursor mRNA expression and cell-cycle progression.
16627760 High levels of CASP8AP2 expression were associated with a greater propensity of leukemic lymphoblasts to undergo apoptosis
15698540 FLASH differentially suppresses steroid hormone receptor-induced transcriptional activity by interfering with their association with steroid hormone receptor coactivator 2 (SRC2)/N-CoA2 and SRC3/N-CoA3
15592525 endogenous caspase-8 mediates tumor necrosis factor-alpha-induced activation of NF-kappaB via FLASH

AA Sequence

MAADDDNGDGTSLFDVFSASPLKNNDEGSLDIYAGLDSAVSDSASKSCVPSRNCLDLYEEILTEEGTAKE      1 - 70
ATYNDLQVEYGKCQLQMKELMKKFKEIQTQNFSLINENQSLKKNISALIKTARVEINRKDEEISNLHQRL     71 - 140
SEFPHFRNNHKTARTFDTVKTKDLKSRSPHLDDCSKTDHRAKSDVSKDVHHSTSLPNLEKEGKPHSDKRS    141 - 210
TSHLPTSVEKHCTNGVWSRSHYQVGEGSSNEDSRRGRKDIRHSQFNRGTERVRKDLSTGCGDGEPRILEA    211 - 280
SQRLQGHPEKYGKGEPKTESKSSKFKSNSDSDYKGERINSSWEKETPGERSHSRVDSQSDKKLERQSERS    281 - 350
QNINRKEVKSQDKEERKVDQKPKSVVKDQDHWRRSERASLPHSKNEITFSHNSSKYHLEERRGWEDCKRD    351 - 420
KSVNSHSFQDGRCPSSLSNSRTHKNIDSKEVDAMHQWENTPLKAERHRTEDKRKREQESKEENRHIRNEK    421 - 490
RVPTEHLQKTNKETKKTTTDLKKQNEPKTDKGEVLDNGVSEGADNKELAMKAESGPNETKNKDLKLSFMK    491 - 560
KLNLTLSPAKKQPVSQDNQHKITDIPKSSGVCDSESSMQVKTVAYVPSISEHILGEAAVSEHTMGETKST    561 - 630
LLEPKVALLAVTEPRIGISETNKEDENSLLVRSVDNTMHCEEPICGTETSFPSPMEIQQTESLFPSTGMK    631 - 700
QTINNGRAAAPVVMDVLQTDVSQNFGLELDTKRNDNSDYCGISEGMEMKVALSTTVSETTESILQPSIEE    701 - 770
ADILPIMLSEDNNPKFEPSVIVTPLVESKSCHLEPCLPKETLDSSLQQTELMDHRMATGETNSVYHDDDN    771 - 840
SVLSIDLNHLRPIPEAISPLNSPVRPVAKVLRNESPPQVPVYNNSHKDVFLPNSAHSTSKSQSDLNKENQ    841 - 910
KPIYKSDKCTEADTCKNSPLDELEEGEIRSDSETSKPQESFEKNSKRRVSADVRKSKTIPRRGKSTVCLD    911 - 980
KDSRKTHVRIHQTNNKWNKRPDKSSRSSKTEKKDKVMSTSSLEKIVPIIAVPSSEQEIMHMLRMIRKHVR    981 - 1050
KNYMKFKAKFSLIQFHRIIESAILSFTSLIKHLNLHKISKSVTTLQKNLCDIIESKLKQVKKNGIVDRLF   1051 - 1120
EQQLPDMKKKLWKFVDDQLDYLFAKLKKILVCDSKSFGRDSDEGKLEKTSKQNAQYSNSQKRSVDNSNRE   1121 - 1190
LLKEKLSKSEDPVHYKSLVGCKKSEENYQDQNNSSINTVKHDIKKNFNICFDNIKNSQSEERSLEVHCPS   1191 - 1260
TPKSEKNEGSSIEDAQTSQHATLKPERSFEILTEQQASSLTFNLVSDAQMGEIFKSLLQGSDLLDSSVNC   1261 - 1330
TEKSEWELKTPEKQLLETLKCESIPACTTEELVSGVASPCPKMISDDNWSLLSSEKGPSLSSGLSLPVHP   1331 - 1400
DVLDESCMFEVSTNLPLSKDNVCSVEKSKPCVSSILLEDLAVSLTVPSPLKSDGHLSFLKPDMSSSSTPE   1401 - 1470
EVISAHFSEDALLEEEDASEQDIHLALESDNSSSKSSCSSSWTSRSVAPGFQYHPNLPMHAVIMEKSNDH   1471 - 1540
FIVKIRRATPSTSSGLKQSMMPDELLTSLPRHGKEADEGPEKEYISCQNTVFKSVEELENSNKNVDGSKS   1541 - 1610
THEEQSSMIQTQVPDIYEFLKDASDKMGHSDEVADECFKLHQVWETKVPESIEELPSMEEISHSVGEHLP   1611 - 1680
NTYVDLTKDPVTETKNLGEFIEVTVLHIDQLGCSGGNLNQSAQILDNSLQADTVGAFIDLTQDASSEAKS   1681 - 1750
EGNHPALAVEDLGCGVIQVDEDNCKEEKAQVANRPLKCIVEETYIDLTTESPSSCEVKKDELKSEPGSNC   1751 - 1820
DNSELPGTLHNSHKKRRNISDLNHPHKKQRKETDLTNKEKTKKPTQDSCENTEAHQKKASKKKAPPVTKD   1821 - 1890
PSSLKATPGIKDSSAALATSTSLSAKNVIKKKGEIIILWTRNDDREILLECQKRGPSFKTFAYLAAKLDK   1891 - 1960
NPNQVSERFQQLMKLFEKSKCR                                                   1961 - 1982
//

Text Mined References (52)

PMID Year Title
25599959 2015 Regional Bias of Intratumoral Genetic Heterogeneity of Apoptosis-Related Genes BAX, APAF1, and FLASH in Colon Cancers with High Microsatellite Instability.
25530566 2015 Low expressions of ARS2 and CASP8AP2 predict relapse and poor prognosis in pediatric acute lymphoblastic leukemia patients treated on China CCLG-ALL 2008 protocol.
25339177 2014 A conserved interaction that is essential for the biogenesis of histone locus bodies.
25238250 2014 FLASH/casp8ap2 is indispensable for early embryogenesis but dispensable for proliferation and differentiation of ES cells.
24941917 2014 Solution NMR structures of homeodomains from human proteins ALX4, ZHX1, and CASP8AP2 contribute to the structural coverage of the Human Cancer Protein Interaction Network.
24397596 2014 Significance of CASP8AP2 and H2AFZ expression in survival and risk of relapse in children with acute lymphoblastic leukemia.
23953914 2013 Hypermethylation of two CpG sites upstream of CASP8AP2 promoter influences gene expression and treatment outcome in childhood acute lymphoblastic leukemia.
23673342 2013 SUMO regulates proteasome-dependent degradation of FLASH/Casp8AP2.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23086935 2012 Poly-small ubiquitin-like modifier (PolySUMO)-binding proteins identified through a string search.
23071092 2013 A complex containing the CPSF73 endonuclease and other polyadenylation factors associates with U7 snRNP and is recruited to histone pre-mRNA for 3'-end processing.
22595458 2012 Targeted Casp8AP2 methylation increases drug resistance in mesenchymal stem cells and cancer cells.
22427918 2012 FLASH knockdown sensitizes cells to Fas-mediated apoptosis via down-regulation of the anti-apoptotic proteins, MCL-1 and Cflip short.
22216762 2012 Systems-wide RNAi analysis of CASP8AP2/FLASH shows transcriptional deregulation of the replication-dependent histone genes and extensive effects on the transcriptome of colorectal cancer cells.
21725362 2012 FLASH is essential during early embryogenesis and cooperates with p73 to regulate histone gene transcription.
21696825 2012 CASP8AP2 is a promising prognostic indicator in pediatric acute lymphoblastic leukemia.
21338522 2011 PIAS1 interacts with FLASH and enhances its co-activation of c-Myb.
21245389 2011 FLASH is required for the endonucleolytic cleavage of histone pre-mRNAs but is dispensable for the 5' exonucleolytic degradation of the downstream cleavage product.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
20109966 2010 Expression and prognostic significance of the apoptotic genes BCL2L13, Livin, and CASP8AP2 in childhood acute lymphoblastic leukemia.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19854135 2009 FLASH, a proapoptotic protein involved in activation of caspase-8, is essential for 3' end processing of histone pre-mRNAs.
19773279 2009 Association between genetic variants in VEGF, ERCC3 and occupational benzene haematotoxicity.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19615980 2009 SUMO modification regulates the transcriptional activity of FLASH.
19593445 2009 Expression of the Bcl-2 protein BAD promotes prostate cancer growth.
19573080 2009 Common genetic variants in candidate genes and risk of familial lymphoid malignancies.
19546234 2009 Interaction of FLASH with arsenite resistance protein 2 is involved in cell cycle progression at S phase.
19414860 2009 Genetic variation in caspase genes and risk of non-Hodgkin lymphoma: a pooled analysis of 3 population-based case-control studies.
19406988 2009 High-resolution genomic profiling of childhood T-ALL reveals frequent copy-number alterations affecting the TGF-beta and PI3K-AKT pathways and deletions at 6q15-16.1 as a genomic marker for unfavorable early treatment response.
18677100 2008 FLASH and NPAT positive but not Coilin positive Cajal Bodies correlate with cell ploidy.
18408764 2008 FLASH acts as a co-activator of the transcription factor c-Myb and localizes to active RNA polymerase II foci.
18038312 2008 Mutational analysis of FLASH and PTPN13 genes in colorectal carcinomas.
17696945 2007 Immunohistochemical and mutational analysis of FLASH in gastric carcinomas.
17525332 2007 ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage.
17245429 2007 FLASH links the CD95 signaling pathway to the cell nucleus and nuclear bodies.
17003126 2006 FLASH is an essential component of Cajal bodies.
17003125 2006 FLASH is required for histone transcription and S-phase progression.
16627760 2006 Genes contributing to minimal residual disease in childhood acute lymphoblastic leukemia: prognostic significance of CASP8AP2.
15698540 2004 FLASH interacts with p160 coactivator subtypes and differentially suppresses transcriptional activity of steroid hormone receptors.
15592525 2005 Role of FLASH in caspase-8-mediated activation of NF-kappaB: dominant-negative function of FLASH mutant in NF-kappaB signaling pathway.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12477726 2003 Tumor necrosis factor alpha receptor- and Fas-associated FLASH inhibit transcriptional activity of the glucocorticoid receptor by binding to and interfering with its interaction with p160 type nuclear receptor coactivators.
12168954 2002 Construction of expression-ready cDNA clones for KIAA genes: manual curation of 330 KIAA cDNA clones.
11340079 2001 FLASH coordinates NF-kappa B activity via TRAF2.
10718198 2000 Prediction of the coding sequences of unidentified human genes. XVI. The complete sequences of 150 new cDNA clones from brain which code for large proteins in vitro.
10537104 1999 Apoptosis. Searching for FLASH domains.
10235259 1999 The CED-4-homologous protein FLASH is involved in Fas-mediated activation of caspase-8 during apoptosis.