Property Summary

NCBI Gene PubMed Count 648
PubMed Score 2954.74
PubTator Score 2090.69

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Disease Target Count Z-score Confidence
Autoimmune Lymphoproliferative Syndrome 12 3.977 2.0
Breast cancer 3098 0.0 5.0

Expression

  Differential Expression (15)

Disease log2 FC p
cutaneous lupus erythematosus 1.800 4.3e-03
psoriasis 2.100 4.5e-05
glioblastoma 2.300 8.3e-04
osteosarcoma 1.691 4.7e-04
posterior fossa group B ependymoma 2.900 4.5e-17
atypical teratoid / rhabdoid tumor 1.400 8.1e-03
intraductal papillary-mucinous neoplasm ... 1.600 7.4e-04
lung cancer -2.700 1.6e-05
breast carcinoma 1.200 1.8e-02
adult high grade glioma 2.400 4.7e-07
pilocytic astrocytoma 2.000 1.5e-09
primary Sjogren syndrome 1.100 1.3e-02
subependymal giant cell astrocytoma 2.322 2.4e-02
lung carcinoma -2.200 1.5e-31
ovarian cancer 1.100 4.1e-03

Gene RIF (551)

PMID Text
26990987 procaspase-8:c-FLIPL exhibits localized enzymatic activity and is preferentially an activator, promoting DED-mediated procaspase-8 oligomer assembly, whereas procaspase-8:c-FLIPS lacks activity and potently blocks procaspase-8 activation
26758508 we conclude that some SNPs in CASP8 are associated with subtype-specific breast cancer risk. This study contributes to our understanding of CASP8 SNPs and breast cancer risk by subtype.
26690594 Frequencies of SNPs rs2234978 and rs1045487 of FAS and CASP8 genes were significantly higher in Autoimmune Lymphoproliferative Syndrome patients.
26563540 Excessive TLR9 signaling contributed to maternal-fetal tolerance disruption via an effect on Treg cell survival by activation of Caspase 8/3
26510914 Data show that when death receptor 5 (DR5) is suppressed, caspase-8 may recruit and stabilize TNF receptor-associated factor 2 (TRAF2) to form a metastasis and invasion signaling complex, resulting in activation of ERK signaling.
26468282 ASC induces procaspase-8 death effector domain filaments
26466953 Internalized Cryptococcus neoformans Activates the Canonical Caspase-1 and the Noncanonical Caspase-8 Inflammasomes.
26437781 A20 targets caspase-8 and FADD to protect HTLV-I-infected cells.
26370846 procaspase-8 death effector domain chain that is crucial for its activation and subsequent cell death
26107208 A frame-shift and a novel missense mutation in CASP8 gene is associated with oral Squamous Cell Carcinoma.
26055088 TNFRSF1A, CASP3 and CASP8 gene variants were not associated with Achilles tendinopathies in British Caucasians.
26010168 The phylogenetic distribution of caspase-8, the initiator caspase of the extrinsic apoptotic pathway. [Review]
26003730 The study reports the first crystal structure of the death effector domains of caspase-8.
25962125 a novel small molecule that not only stimulates TRAIL-induced apoptosis in cancer cells, but may also provide insights into the structure-function relationship of caspase 8 homodimers as putative targets in cancer.
25914458 Casp8-dependent migration of enterocytes is likely involved in intestinal physiology and inflammation-related pathophysiology.
25855521 Authors observed that the extracellular region of the EphA7 receptor was critical for interacting with caspase-8, whereas the cytoplasmic region of EphA7 was not.
25855136 rs13014235[C] is associated with susceptibility to cutaneous basal cell carcinoma.
25850729 LtxA kills malignant lymphocytes by a novel mechanism requiring the death receptor Fas and caspase-8
25815518 VPA and ATO had synergistic effects on the proliferation of RPMI8226 cells, which may have been associated with the decreased expression of Bcl-2 and the increased expression levels of Bcl-2-associated X protein, Caspase 8 and Caspase 9
25697054 in the absence of caspase-8 activity, 24(S)-Hydroxycholesterol induces a necroptosis-like cell death which is RIPK1-dependent but MLKL-independent.
25665064 Silver nanoparticles biosynthesized using Achillea biebersteinii flower extract: apoptosis induction in MCF-7 cells via caspase activation and regulation of Bax and Bcl-2 gene expression.
25553350 Genetic variations within the CASP8 gene are biomarkers for cancer risk.
25526311 contributes to dysfunctional proliferation of HIV-specific CD8+ T cells
25502557 CASP8 SNP D302H (rs1045485) is associated with worse survival in MYCN-amplified neuroblastoma patients
25476903 RIPK1 indirectly regulates caspase-8 activation, in part via interaction with the ER stress sensor IRE1.
25451151 review of caspase-8 and its role in modulating IL-1beta and inflammation [review]
25450619 RIPK3 serves as a negative regulator of selective autophagy by regulating regulates p62-LC3 complex formation via the caspase-8-dependent cleavage of p62
25403406 proinflammatory (caspase 1) and initiator (caspases 8 and 10) caspases in the syncytiotrophoblast and capillary endotheliocytes of the terminal villi are higher in induced pregnancies.
25352594 Caspase-8 and caspase-3 activity are required for HIV-1 Vpu-induced cleavage of IRF3 and HIV-1 infection also induces caspase-mediated IRF3 cleavage
25349431 DICER1/Alu RNA dysmetabolism induces Caspase-8-mediated cell death in age-related macular degeneration.
25347010 These data imply an unrecognized role for the CASP8 promoter polymorphism on survival following unrelated SCT particularly in the context of T-cell depletion with Alemtuzumab.
25292051 Caspase-8 -652 6N del and D302H polymorphisms are associated with prostate cancer in different ethnic groups.
25246614 Caspase 8 cleavage by HIV protease activates BAK, enabling HIV to kill infected T cells.
25228008 Data show that the signals of cytoplasmic cyclin-dependent kinase inhibitor 1B (p27) and caspase 8 increased and merged together after gefitinib treatment.
25214386 Studied the mechanism of Artemisinin (ARTE)-induced human lung adenocarcinoma (ASTC-a-1) cell apoptosis; results showed ARTE induced the activation of caspase-3, -8 and -9.
25197060 Mechanisms mediating TNFSF15:DR3 contributions to pattern recognition receptor outcomes included TACE-induced TNFSF15 cleavage to soluble TNFSF15; soluble TNFSF15 then led to TRADD/FADD/MALT-1- and caspase-8-mediated autocrine IL-1 secretion.
25189649 HER2 promotes tumor cell survival by inhibiting apoptosis i.e. by downregulating CASP-3 and CASP-8.
25168388 Genome-wide association studies show a significant association between the intronic SNP rs1830298 in ALS2CR12 gene and breast cancer; further expression studies suggest that CASP8 might be the target gene.
25132643 caspase-8 and LC3 are ubiquinated and have roles in 2',3'-dimethoxyflavanone-induced apoptosis in breast cancer stem cells
25060909 Knock-down of caspase 8 expression lead to inhibition of hMSCs apoptosis, reduction of caspase 8 activity and up-regulations of HGF, IGF-1 and Bcl-2.
25059065 soluble apoptosis markers as sFas-L, Caspase-9, Caspase-8 and sCD153 were significantly higher in stage III obesity patients compared obese patients without food allergy
24990442 these results demonstrate that mitochondrial apoptosis is not required for NLRP3 activation, and highlight an important non-apoptotic role for caspase-8 in regulating inflammasome activation and pro-inflammatory cytokine levels.
24934366 TIPE2 can regulate TLR4 inflammatory effect and inhibit further amplification of cascade reaction via caspase-8.
24931006 our results indicate that the mechanism by which PAR-4 orchestrates the apoptotic process requires cleavage by caspase-8.
24839934 Data confirmed that levels of PinX1 and caspase 3, 8 and 9 expression were closely linked to the poor prognosis of colorectal cancer.
24819879 A second CASP8 promoter was identified located upstream of the caspase-8 isoform G.
24816188 Three of the four procaspase-8 mutants promoted enhanced cellular migration and invasion through matrigel, relative to that seen with the wild-type procaspase-8 protein.
24810056 Combination of a perforin (PF)-CEBPD prodrug (which increases level of procaspase-8) and a PF-granzyme B prodrug (which activates CASP8/CASP3)) showed an additive effect in triggering the apoptotic pathway/enhancing apoptosis in prostate cancer cells.
24762656 The study reveals a novel pathway for FLIP regulation of NF-kappaB through protein S-nitrosylation, which is a key posttranslational mechanism controlling DR-mediated cell death and survival.
24621205 no association between CASP8 gene polymorphisms with immunoglobulin A nephropathy
24619646 Intra- and interdimeric caspase-8 self-cleavage controls strength and timing of CD95-induced apoptosis.
24589337 observations reveal a novel mechanism for neutrophil-mediated tissue injury through oxidant-dependent, SHP-1-mediated dephosphorylation of caspase-8
24561085 Fas-Fas-ligand signal transduction could be inhibited, especially at the stage of caspase-8 activation, thereby establishing a major mechanism for evasion of apoptosis by these tumors
24535941 CASP8 -652 6N ins>del polymorphism is associated with protective effect on gastric cancer.
24530529 Apoptotic progression is markedly attenuated by ATM gene knockdown through downregulation of caspase-8 and caspase-9.
24503077 HPV E6 oncoproteins to recruit active caspase 8 to the nucleus.
24498403 CASP8 polymorphism contributes to colorectal cancer susceptibility.
24484936 Procaspase-8 is regulated during the cell cycle through the concerted inhibitory action of Cdk1/cyclin B1 and polo-like kinase 1 (Plk1).
24465592 analysis indicated rs3834129 was not associated with colorectal cancer (CRC) risk in the full data set; however, the del allele was under-represented in one set of cases with a family history of CRC suggesting this allele might be a protective factor versus familial CRC
24464182 the functional polymorphism CASP8 rs1035142 G>T might contribute to ESCC susceptibility.
24457433 Meta-analyses of the available data suggest that CASP8 -652 6N del polymorphism is associated with reduced breast cancer risk.
24442637 There is a mechanism to regulate death receptor-mediated apoptosis via an interaction between FAT1 and procaspase-8.
24438025 TRAIL promoted either mitogenesis or migration of HUVEC, evaluated using the wound healing method. Cleavage of caspase 8 was evaluated along with expression of the caspase 8-like molecule, cellular FLICE-inhibitory protein (long form) (c-FLIPL).
24412083 Hemimethylation of the CASPASE-8 promoter was found in 11.8% of normal ovary samples, 20% of cystadenoma tumors and 20% of the metastatic epithelial ovarian cancer, while methylation of the CASPASE-8 promoter was absent in the EOC primary tissues
24398693 the C-terminal domain of c-FLIPL specifically inhibits the interaction of the caspase 8 prodomain with the RIP1 death domain and, thereby, regulates caspase 8-dependent NF-kappaB activation.
24391214 In virus-infected cells, a Bax/Bak-independent pathway involves dsRNA-induced innate immune signaling via mitochondrial antiviral signaling (MAVS) and caspase-8.
24342355 pERK 1/2 inhibit Caspase-8 induced apoptosis in cancer cells by phosphorylating it in a cell cycle specific manner.
24209510 Cytosolic and nuclear caspase-8 have opposite impact on survival after liver resection for hepatocellular carcinoma.
24149212 Epigenetic modifications affecting the promoters of ZNF154, CASP8, and VHL are shared across a vast array of tumor types and may therefore be important for understanding the genomic landscape of cancer.
24127565 Lysosomal exocytosis is part of the keratinocyte response to UVA and is followed by cathepsin-dependent activation of caspase-8.
24121507 up-regulation of p62 can mediate apoptosis via caspase-8 in the setting of autophagy inhibition.
24097299 These results suggest that TRAIL inhibits VEGF-induced angiogenesis by increasing caspase-8 activity and subsequently decreasing non-apoptotic signaling functions of procaspase-8, without inducing caspase-3 activation and endothelial cell cytotoxicity.
24021263 This study first time demonstrated the role of TRIM13 as novel regulator of caspase-8 activation and cell death during endoplasmic reticulum stress.
23982205 Data indicate that the ASK1-FoxO3a-TRADD-caspase 8 pathway is present in neural tube defects (NTDs)-affected tissues.
23921907 Single nucleotide polymorphisms in CASP8 gene is associated with gastric cancer.
23867815 Caspase-8 and caspase-3 activity are required for HIV-1 Vpu-induced cleavage of IRF3 and HIV-1 infection also induces caspase-mediated IRF3 cleavage
23844036 Genetic polymorphisms of the CASP8 gene promoter may not be associated with colorectal cancer in Han Chinese from southwest China.
23751956 Data show Src-inducible association of CrkL with procaspase-8 promotes cell migration.
23659359 Most CASP8 mutations previously detected in various epithelial tumors also increase the ability of the protein to activate NF-kappaB signaling.
23618862 Data show that YM155 induces apoptosis in leukemia cells through downregulation of survivin and Mcl-1, and that caspase-8 may play a critical role during apoptosis.
23479148 the rs7608692*A allele of CASP8 might be a risk factor for cancer risk in Asian populations (Review)
23443079 siRNA-based gene inactivation of caspase-8 effectively delays caspase-9 activation and apoptosis induced by G-Rh2, indicating that caspase-8 also plays an important role in the G-Rh2-induced apoptosis program.
23434145 Aldehyde dehydrogenase 1, cleaved caspase 3, and cyclooxygenase 2 are useful markers for therapeutic resistance in breast cancer.
23418437 Caspase-8 binding to cardiolipin in giant unilamellar vesicles provides a functional docking platform for bid
23364796 Caspase-8 and caspase-3 activity are required for HIV-1 Vpu-induced cleavage of IRF3 and HIV-1 infection also induces caspase-mediated IRF3 cleavage
23313206 The del/del genotype of the CASP8 -652 6N ins/del promoter polymorphism decreases the overall risk of renal cell carcinoma. It may be associated with a decreased risk of metastasis.
23306557 Caspase-8 is significantly more active at the plasma membrane than within the cytosol upon CD95 activation.
23289213 An increase of genotype frequency of BCL2*C/*C and decrease of genotype frequency of CASP8*I/*D was observed in male of senile age
23255602 Smad7 was able to activate the caspase 8 promoter through recruitment of the interferon regulatory factor 1 (IRF1) transcription factor to the interferon-stimulated response element (ISRE) site.
23244104 Low expression of caspase 3 is associated with oral squamous cell carcinoma and peritumoral tissue.
23230268 Apoptosis-related genes such as the caspase-8, FLIP, and DR5 genes specifically interfere with interferon-induced apoptosis.
23185580 Focal activation of CASP8 is sufficient to propagate apoptotic signals through death receptors.
23142077 TRAF2 sets a critical barrier for cell-Extrinsic apoptosis commitment by tagging activated caspase-8 with a K48-ubiquitin shutoff timer.
23109891 EG also activated the death receptor-dependent pathway of apoptosis by enhancing the expression of caspases-8, -9, and -3 and the Bcl-2 interacting domain (Bid).
23096115 FADD and the initiator caspase-8 mediate activation of NF-kappaB by TRAIL.
23081800 Progenitor stimulation is selectively mediated by TNF-R1 and involves activation of caspase-8, without redundant activity of TNF-R2.
23071110 procaspase-8 activity is essential for cell survival by inhibiting both apoptotic and nonapoptotic cell death dependent on receptor-interacting protein kinase 1 (RIP1) and RIP3
22971934 Caspase-8 and caspase-3 activity are required for HIV-1 Vpu-induced cleavage of IRF3 and HIV-1 infection also induces caspase-mediated IRF3 cleavage
22949938 Knockdown of caspase recruitment domain (ARC) promoted caspase-8, caspase-3 activation and Bax accumulation in glioma.
22942738 data strongly indicate that the inhibition of ceramide conversion to complex sphingolipids by D609 is accompanied by an enhancement of FasL-induced caspase-dependent and -independent cell death in T lymphocytes.
22922291 TNF-alpha treatment led to intracellular Her-2 cleavage via a caspase-8-dependent signaling pathway in MCF-7 cells defective for NFkappa B activation.
22860893 Data indicate that recombinant (r)IL-24 stimulated the mitochondrial apoptotic pathway genes Bax, Bid, Casp8, COX6C, COX7B after 36 h.
22843554 Genetic variations in CASP8 and CASP10 may act as potential predictive biomarkers for platinum-based chemotherapy toxicity in Chinese non-small cell lung cancer patients.
22820578 Decreased CASP8 expression is an unfavorable factor that promotes the development and progression of nasopharyngeal carcinoma.
22815944 analysis of Fas mediated caspase-8 independent apoptosis in human and mouse immune cells by Armigeres subalbatus saliva
22806078 These results represent the first evidence indicating that the two death receptors, Fas and P2X7R connect functionally via caspase-8 and pannexin 1 hemichannel-mediated ATP release to promote caspase-9/caspase-3-dependent cell death in lymphoid cells.
22801217 These findings demonstrate the precise cascade of CASP8-mediated apoptotic signals through the extrinsic pathway.
22691345 Caspase-8 is not only an apoptosis protein, but has non-apoptosis function, such as promoting invasion and metastasis of lung cancer A549 cell.
22683266 description of the DISC model in which DED chain assembly drives caspase-8 dimerization/activation, thereby triggering cell death
22683265 analysis of stoichiometry of the CD95 death-inducing signaling complex and demonstration of how procaspase-8, procaspase-10, and c-FLIP form DED chains at the DISC, enabling the formation of dimers and efficient activation of caspase-8
22672670 High methylation frequency of tested genes shows heterogeneity of glioblastoma epigenome and the importance of MGMT, GATA6 and CASP8 genes methylation in glioblastoma patient outcome.
22659694 An inverse association between CASP8 6N del variant and the risk of breast cancer (OR=0.66, 95% CI=0.66-0.87, p=0.002) was found.
22644571 caspase-8 overexpression led to Atg3 degradation and this event depended on caspase-8 enzymatic activity
22632162 Caspase-8 and caspase-3 activity are required for HIV-1 Vpu-induced cleavage of IRF3 and HIV-1 infection also induces caspase-mediated IRF3 cleavage
22588838 CASP8_rs1045485 and CASP8_rs3834129 associated with Achilles tendinopathy risk
22528489 cathepsin D is able to initiate the caspase cascade by direct activation of caspase-8.
22513478 there is an association between the CASP8 -652 6N del polymorphism and reduced cancer risk, especially among Asians, Caucasians and those with colorectal cancer.
22508042 Src is required for caspase-8-imparted cell migration or metastasis dependently on Tyr 380 and RXDLL motif of caspase-8.
22421964 dsRNA induces apoptosis through an atypical death complex associating TLR3 to caspase-8.
22408249 Proteasome inhibition can impair caspase-8 activation upon submaximal stimulation of apoptotic tumor necrosis factor-related apoptosis inducing ligand (TRAIL) signaling.
22383778 Effects of hypoxia on apoptosis differ between fetal organs; data suggest that chronic hypoxia decreases caspase 3 activity in fetal heart but increases caspase 3 activity in fetal brain tissue.
22357491 CASP8-652 6N DD genotype may play a role in coal worker pneumoconiosis development and interact with SNPs of FAS-1377, FAS-670 and FASL-844.
22339913 Caspase-8 and caspase-9 expression was reduced in patients with chronic mountain sickness.
22267217 dectin-1 acted as an extracellular sensor for pathogens that induced both IL-1beta production and maturation through a noncanonical caspase-8-dependent inflammasome for protective immunity
22253841 The RNA fragments signaled through a caspase-8 dependent, caspase-1 and TNF-alpha independent pathway that ultimately compromised the human monocytes' ability to control M. tuberculosis infection.
22211869 Results indicate that FAS-FASL-CASP8 polymorphisms contributed to a reduced risk of childhood lymphoblastic leukemia (ALL) in Chinese population.
22160860 Caspase-8 isoform 6, as a new physiological modulator of apoptosis, promotes death effector filament formation independent of microtubules.
22120515 Caspase 8 (-652 6 N ins/del) genotype variant was not associated with papillary thyroid carcinoma (PTC) susceptibility.
22094081 Caspase-8 and caspase-3 activity are required for HIV-1 Vpu-induced cleavage of IRF3 and HIV-1 infection also induces caspase-mediated IRF3 cleavage
22056502 Authrors identified a three-SNP haplotype across rs3834129, rs6723097, and rs3817578 in CASP8 that was significantly associated with breast cancer.
22046053 We propose models for the progression of apoptosis in villous cytotrophoblasts and for why caspase8-mediated apoptosis does not occur within the syncytium of placental villi.
22037414 Following tumor necrosis factor stimulation, caspase 8 cleaves CYLD to generate a survival signal.
22027693 This study identifies SART1 as a previously unidentified regulator of c-FLIP and drug-induced activation of caspase-8.
22010212 Results indicate that caspase-8 is crucial for the high antileukemic efficiency of numerous routine cytotoxic drugs.
21979465 FADD cleavage by NK cell granzyme M enhances its self-association to facilitate procaspase-8 recruitment for auto-processing leading to caspase cascade.
21868312 The apoptosis-inducing effect of Caspase-8 was a dominant feature in the cartilage pathology of Kashin-Beck disease compared to the apoptosis-suppressing effect of Bcl-2.
21865223 Results demonstrated that CIDEC-induced apoptosis was independent of FADD, suggesting that CIDEC-induced apoptosis might be in a death-receptor-independent, caspase-8-dependent manner.
21819468 The expression of bax gene was more intense than caspase-8 but both did not show difference between primary tooth pulps with root resorption and control permanent teeeth
21816816 Caspase-8-mediated cleavage of IRF-3 helps to modulate dsRNA-dependent gene induction.
21801448 The importance of caspase-8-mediated positive feedback amplification in the p53/p73-dependent apoptosis induced by etoposide in HNSCC cells.
21785459 DJ-1 protects against TRAIL-induced apoptosis through the regulation of death-inducing signaling complex (DISC) formation.
21785112 Data indicate that NGA could increase the expression of the apoptosis-related proteins FasL, caspase-3, caspase-8, caspase-9, and Bax and decrease the expression of anti-apoptotic protein Bcl-2 accompanied by the mitochondrial transmembrane damage.
21751259 Data show that G-Rh2 and Bet A cooperated to induce Bax traslocation to mitochondria and cytochrome c release, and enhanced cleavage of caspase-8 and Bid.
21724551 Mechanistic studies showed that MLN2238-triggered apoptosis is associated with activation of caspase-3, caspase-8, and caspase-9.
21714991 Genetic variants of the CASP8 gene protect against epithelial ovarian cancer carcinogenesis and delay the age of EOC onset. Protective effects may be due to the dysfunctional expression of caspase-8 caused by the -652 6N del variant in the promoter.
21704196 This review discusses the latest insights in caspase-8 homo- versus heterodimerization and the implication this has for cellular death or survival.
21697465 Thus, by interacting with caspase 8 and RIP1, HSV R1s impair the apoptotic host defense mechanism prompted by dsRNA.
21669575 Injectable Coix lacryma-jobi seed extract may induce apoptosis in hepatocellular carcinoma cells by regulating the expression of caspase-8.
21667042 Percentages of activated caspase-3 and activated caspase-8 are higher in chronic hepatitis C virus-infected patients. Treatment with GS-9450 resulted in a slight decrease in caspase-8 but a higher drop in caspase-3.
21633787 genetic association studies in Chinese population: No associations were found between polymorphisms in the promoter region of CASP8 gene (rs3834129, rs3769821, rs113686495) and non-Hodgkin's lymphoma.
21628531 inhibition of proteasomal degradation results in increased oligomerization and activation of caspase-8 on intracellular membranes; enhanced caspase-8 oligomerization and activation are promoted through interaction with SQSTM1/p62 and (LC3)
21576355 Data suggest that SCCA1 inhibits cell death induced by lysosomal injury while, on the other hand, it sensitizes cells to ER stress by activating caspase-8 independently of the death receptor apoptotic pathway.
21569377 Data show that suppression of microglial MMP-2 secretion by M tuberculosis-infected monocytes involves the pro-inflammatory mediators TNF-alpha, p38 MAP kinase and NFkappaB in addition to a novel caspase 8-dependent pathway.
21554547 YC-1 may enhance the apoptotic effect of TRAIL on ovarian carcinoma cell lines by increasing the activation of the caspase-8- and Bid-dependent pathways.
21548803 Apigenin increases CASP3 and CASP8 mRNA expression but decreases mTOR and CCND1 mRNA expression in HT29 cells.
21538054 The association between CASP8 and CASP9 gene polymorphisms and colorectal cancer (CRC) susceptibility, was investigated.
21525013 TWEAK induces apoptosis through a death-signaling complex comprising receptor-interacting protein 1 (RIP1), Fas-associated death domain (FADD), and caspase-8
21524651 the interleukin-21 signaling cascade is negatively regulated by CASP8.
21487429 Induction of caspase 8 protein expression is the key factor of rhTRAIL sensitisation.
21483669 Caspase-8 and caspase-3 activity are required for HIV-1 Vpu-induced cleavage of IRF3 and HIV-1 infection also induces caspase-mediated IRF3 cleavage
21461653 Caspase 8 -652 6N ins/del polymorphism was observed to play a protective role in gastric cancer predisposition.
21454681 Cellular FLICE-inhibitory protein (cFLIP) isoforms block CD95- and TRAIL death receptor-induced gene induction irrespective of processing of caspase-8 or cFLIP in the death-inducing signaling complex
21444671 autophagy is inhibited during chemotherapy-induced apoptosis by caspase 8-mediated cleavage of Beclin 1 after cytochrome c release
21436691 High caspase-8 activity is associated with cervical malignancy.
21426305 although staurosporine-mediated caspase activation and FAK cleavage was delayed in the mtp53-R 175H HOSCC cell line, caspase-8 activation and FAK dephosphorylation were induced by increasing the apoptotic stimulus.
21419663 Conjugation of ubiquitin chains to RIP1 facilitated assembly of the RIG-I complex, resulting in enhanced phosphorylation of IRF3
21396853 results suggested that the CASP 8 IVS12-19G/A and CASP 9 -1263 polymorphism may be involved in etiology of prostate cancer
21380726 Data indicate that Akt inhibitor may potentiate the apoptotic effect of trichostatin A on ovarian carcinoma cell lines by increasing the activation of the caspase-8-dependent pathway.
21328377 results show CASP8 -652 6N del/del genotype increases risk of abnormal cytology and high-risk HPV infection but does not show association with cervical cancer; result points to an important role of CASP8 in HPV infection and development of pre-cancers
21248767 TRAIL can be an inducer of both differentiation and apoptosis in human keratinocytes, and that caspases critically mediate these processes
21183680 data provide a direct link between RSK2 and caspase-8 and identify a novel molecular mechanism for caspase-8 modulation by RSK2
21178828 Data show that the expression of apoptosis proteins caspase-3,-8,-9, and Bid in the RNP of the disc and the SNP was different in each patient.
21166494 Silibinin-induced apoptosis in MCF7 and T47D human breast carcinoma cells involves caspase-8 activation and mitochondrial pathway.
21157428 Caspase-8 and caspase-7 sequentially mediate proteolytic activation of acid sphingomyelinase in TNF-R1 receptosomes.
21153367 TNF-R1-associated caspase-8 mediates activation of acid sphingomyelinase in late endosomes
21135236 Development of atopic dermatitis-like skin disease from the chronic loss of epidermal caspase-8.
21107701 Individually expressed HSV-1 R1 (ICP6) shares, with HSV-2 R1, the ability to bind caspase-8 and to protect cells against death receptor-induced apoptosis.
21104989 Hypermethylation of CASP8 gene is associated with relapse in neuroblastoma.
21072056 Cells stabilize active caspase-8 on the mitochondria in order to specifically target mitochondria-associated BID.
21048031 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20978178 CASP8 D302H decreases breast and ovarian cancer risk for BRCA1 mutation carriers but not for BRCA2 mutation carriers.
20978178 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20978129 Activation of caspase-9, but not caspase-2 or caspase-8, is essential for heat-induced apoptosis in Jurkat cells.
20959405 Observational study of gene-disease association. (HuGE Navigator)
20951133 TRAIL-mediated apoptosis proceeds through caspase 8-dependent degradation of cIAP-1.
20937773 Data demonstrate that procaspase-8 is phosphorylated in mitotic cells by Cdk1/cyclin B1 on Ser-387, which is located at the N terminus of the catalytic subunit p10.
20877624 Observational study of gene-disease association. (HuGE Navigator)
20870287 investigation of role of placental caspase 8 in syncytialization: inhibitors of caspase 8 activation do not block differentiation of cytotrophoblasts to form syncytiotrophoblasts
20855536 Observational study of gene-disease association. (HuGE Navigator)
20829884 Prx6 modulates TRAIL signaling as a negative regulator of caspase-8 and caspase-10 in death-inducing signaling complex formation of TRAIL-resistant metastatic cancer cells.
20819778 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20817393 review of Caspase-8 as a therapeutic target in cancer [review]
20811726 Colon cancer cells can acquire rhTRAIL resistance by primarily reducing the basal procaspase 8/c-FLIP ratio and by increasing active caspase 8 degradation after rhTRAIL treatment.
20808443 DR5 and caspase-8 are involved in regulation of HNSCC metastasis.
20804486 Study results associate CASP9 and CASP8 gene polymorphisms with risk of prostate cancer & CASP8 may be responsible for decreased apoptosis in patients on androgen withdrawal therapy, thereby leading to early advancement to androgen-insensitive state.
20804486 Observational study of gene-disease association. (HuGE Navigator)
20802294 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20800603 Observational study of gene-disease association. (HuGE Navigator)
20799830 Collectively, our findings demonstrate for the first time that DHA induces cell apoptosis by triggering ROS-mediated caspase-8/Bid activation.
20724831 Results suggest that the TRAIL-mediated autophagic response counter-balances the TRAIL-mediated apoptotic response by the continuous sequestration of the large caspase-8 subunit in autophagosomes and its subsequent elimination in lysosomes.
20702410 a central and so far underappreciated role of caspase-8 dimerization/dissociation in avoiding unwanted cell death by lethal amplification of caspase responses via the caspase-8, -3, -6 loop.
20677014 Observational study of gene-disease association. (HuGE Navigator)
20661084 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20652397 the minor allele del of CASP8 rs3834129 is associated under a dominant model with increased breast cancer risk in carriers of BRCA1 mutations but not in carriers of BRCA2 mutations
20652397 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20644561 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20616437 human endocrine tumors lacking menin may not always exhibit lowered caspase 8 expression and hence may not be resistant to apoptosis-inducing therapy.
20613771 Caspase-8 was activated earlier in beta(1)B integrin-transfected keratinocytes, and these cells underwent a higher rate of apoptosis than mock cells. In contrast, caspase-8 was not activated in small interfering RNA (siRNA) beta(1)B-transfected cells
20606168 The NPM mutant specifically inhibits the activities of the cell-death proteases, caspase-6 and -8, through direct interaction with their cleaved, active forms, but not the immature procaspases.
20605201 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20572163 Functional polymorphism in cell death pathway CASP8 gene and risk of renal cell carcinoma are reported.
20572163 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20565257 These results suggest that Casp8p41 is a relevant mediator of CD4 T cell death during HIV infection.
20564345 In this study, the CASP8 -652 6N ins/del polymorphism was associated with significantly decreased risk of gallbladder cancer in a northern Indian populati.on
20564345 Observational study of gene-disease association. (HuGE Navigator)
20554749 Observational study of gene-disease association. (HuGE Navigator)
20502973 The p.Asp302His CASP8 variant was associated with reduced ovarian cancer risk in the familial BRCA1/2 mutation negative ovarian cancer
20502973 Observational study of gene-disease association. (HuGE Navigator)
20471133 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20453000 Observational study of gene-disease association. (HuGE Navigator)
20443055 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20404718 Caspase-8 and caspase-3 activity are required for HIV-1 Vpu-induced cleavage of IRF3 and HIV-1 infection also induces caspase-mediated IRF3 cleavage
20403046 34% of patients with hepatocellular carcinoma had promoter methylation of the caspase 8 gene. Immunohistochemical staining of caspase 8 was observed in 48%. This was correlated with apoptosis.
20402676 Observational study of gene-disease association. (HuGE Navigator)
20398055 DNMT1 and DNMT3b silencing sensitizes human hepatoma cells to TRAIL-mediated apoptosis via up-regulation of TRAIL-R2/DR5 and caspase-8.
20379197 Mutant PIK3CA interferes with apoptosis downstream of death receptor-signal complex, allowing caspase-8 activation without apoptosis. Cleavage of ROCK-1 by caspase-8 triggers amoeboid shape and invasiveness of HCT116 cells in response to TRAIL and CD95L.
20363033 These findings point to a role of CASP8 polymorphisms in the MS genetic risk in PPMS patients.
20363033 Observational study of gene-disease association. (HuGE Navigator)
20356928 The interface between apoptosis initiation and execution by determining caspase-8 activation, Bid cleavage and mitochondrial engagement (onset of mitochondrial depolarisation) in individual HeLa, was analysed.
20353946 response to lethal stress, PKR, without being phosphorylated, activates the FADD/caspase-8/caspase-3 pathway to trigger HuR cleavage, and the HuR-CPs are then capable of promoting apoptosis
20308068 caspase-8 activation requires both dimerization and cleavage
20237344 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20198319 A photosensitizer conjugated to a small-molecule PSMA inhibitor is capable of selectively initiating apoptosis via the caspase-8/-3 pathway in PMSA+ prostate tumor cells upon low-intensity light irradiation.
20176653 Meta-analysis of gene-disease association. (HuGE Navigator)
20150972 These results suggest that caspase-8s may act as a promoter of apoptosis through binding to FADD and is involved in the regulation of apoptosis.
20145138 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20143425 we suggest that caspase-2 and/or -8 plays an important role in regulating gamma-secretase and may possibly provide a basis for the development of therapeutics targeting apoptosis
20132554 CASP8 and maspin expression are reduced in breast cancer cells due to promoter methylation
20087649 Reveal a novel function of HspB2 as an anti-apoptotic protein that negatively regulates apical caspase 3/8 activation in the extrinsic apoptotic pathway.
20086182 the CASP8 -652 6N del variant allele may contribute to the risk of developing squamous cell carcinoma of the head and neck in non-Hispanic white populations
20086182 Observational study of gene-disease association. (HuGE Navigator)
20080300 Does caspase 8 play a role in differentiation of villous cytotrophoblast in the placenta? [REVIEW]
20044137 role and regulation of caspase 8 in the villous trophoblast layer of the placenta [REVIEW]
20033885 The histidine variant of CASP8 D302H is a protective allele for aggressive prostate carcinoma with potential utility for identification of patients at differential risk for this clinically significant phenotype.
20033885 Observational study of gene-disease association. (HuGE Navigator)
20033750 Data obtained suggest that the anti-Ro and anti-La antibodies, characterizing Sjogren's syndrome, determine a transcriptional up-regulation and activation of caspase-8.
20013803 High caspase-8 expression is associated with colon carcinoma.
20012528 Caspase-8 and caspase-3 activity are required for HIV-1 Vpu-induced cleavage of IRF3 and HIV-1 infection also induces caspase-mediated IRF3 cleavage
20005201 in human hepatocellular liver carcinoma cells (HepG2 cells) exposed to TNF-alpha and cycloheximide, both NO and HTrxn affect the caspase cascade at its initial stage of activation of caspase 8.
19996275 Data indicate that overexpression of AT2R led to apoptosis via an extrinsic cell death signaling pathway that is dependent on activation of p38 mitogen-activated protein kinase, caspase-8, and caspase-3 and p53.
19954364 TRAIL induced apoptosis in neuroblastoma cells expressing caspase 8.
19923319 These studies identify Rab5 as a key integrator of caspase-8-mediated signal transduction downstream of integrins, regulating cell survival and migration in vivo and in vitro.
19913121 Observational study of gene-disease association. (HuGE Navigator)
19902255 Observational study of gene-disease association. (HuGE Navigator)
19854135 Human FLASH interacts with Lsm11 in vitro and stimulates 3' end processing of histone pre-mRNA in mammalian nuclear extracts.
19852930 These results indicate that the loss of caspase-8 plays an important role in acquisition of chemoresistance to cisplatin in HOC313 cells.
19843670 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19826114 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19812265 Caspase-8 and caspase-3 activity are required for HIV-1 Vpu-induced cleavage of IRF3 and HIV-1 infection also induces caspase-mediated IRF3 cleavage
19807657 The presence of FoxO3a is necessary for the expression of cleaved (active) caspase 3, 8, and 9
19801665 Data suggest that SPE B up-regulates procaspase 8 expression via the JAK2/STAT1 pathway.
19795398 Fndings suggest that the selected polymorphisms of p21, CCND1, and caspase8 may not contribute to the risk of colorectal cancer.
19778795 Both RIP and caspase-8 may play important roles in the occurrence and progression of oral squamous cell carcinoma and oral precancerous lesions.
19773279 Observational study of gene-disease association. (HuGE Navigator)
19770581 Data show that EGCG inhibited KIT activity after 4 h treatment, and induced cell death via caspase-dependent pathways.
19738422 Data show that the N-t-boc-Daidzein induced apoptosis is characterized by caspase activation, XIAP and AKT degradation.
19710364 The interaction between Mib1 and cFLIP decreases the association of caspase-8 with cFLIP, which activates caspase-8 and induces cell death.
19698994 Suppression of p38 MAPK sensitized T cells to Fas-mediated apoptosis and increased caspase-8 and caspase-3 cleavage
19692467 Caspase-8 and caspase-3 activity are required for HIV-1 Vpu-induced cleavage of IRF3 and HIV-1 infection also induces caspase-mediated IRF3 cleavage
19692168 Observational study of gene-disease association. (HuGE Navigator)
19684859 while caspase-8/-10 activity is required for the full induction of cell death with treatment, the death receptor pathways are not. Finally, we demonstrate that basal levels of caspase-8 and Bid correlate with treatment sensitivity
19665028 Data demonstrate the strong inhibition of human initiator and effector caspases 3 and 8 by bovine SERPINA3-1 and A3-3.
19644511 IPS-1 expression, recruitment of caspase-8 to IPS-1, and caspase-8 activation were induced after cell detachment.
19629679 Meta-analysis of gene-disease association. (HuGE Navigator)
19625176 Observational study of gene-disease association. (HuGE Navigator)
19617217 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19597472 Histone deacetylase inhibitors cooperate with IFN-gamma to restore CASP8 expression and overcome TRAIL resistance in cancers with silencing of CASP8.
19573080 Observational study of gene-disease association. (HuGE Navigator)
19550122 Data show that the mDRA-6-induced apoptosis was repressed by 77.9% by Caspase-8 inhibitor ZIF, 54.2% by Caspase-3 inhibitor ZDF, and 8.7% by Caspase-9 inhibitor ZLF, but was not repressed by Caspase-10 inhibitor ZAF.
19543235 Procaspase 8 is frequently overexpressed in non-small-cell lung cancers and that this preferentially sensitizes non-small-cell lung cancers cells to apoptosis induced by FLIP silencing.
19542541 Observational study of gene-disease association. (HuGE Navigator)
19531679 No association was observed between polymorphisms of the caspase-8 gene and risk for endometrial cancer.
19531679 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19528225 Data suggest an alternative mechanism of procaspase-8 activation at the death-inducing signaling complex.
19521670 p18 subunit of caspase-8 was necessary for Bid cleavage and the mitochondria pathway might be dependent on the release of p18 subunit from active caspase-8.
19493480 There was no change of caspse-8 expression in keratinocytes induced by trichloroethylene.
19492233 caspase 8 (CASP8)-652 6N ins/del polymorphism may contribute to the genetic susceptibility for Coal workers' pneumoconiosis development
19492233 Observational study of gene-disease association. (HuGE Navigator)
19470771 provide the first evidence for caspase-8 as an essential component of epidermal growth factor signaling and suggest that this may be due to its association with Src
19453261 Observational study of gene-disease association. (HuGE Navigator)
19432816 This study indicates that the death-inducing signalling complex modification by RIP, c-FLIP and PED/PEA-15 is the most upstream event in TRAIL resistance in glioblastomas.
19427028 The ubiquitin-binding protein p62/sequestosome-1 promoted aggregation of CUL3-modified caspase-8 within p62-dependent foci, leading to full activation and processing of the enzyme and driving commitment to cell death.
19414860 Observational study of gene-disease association. (HuGE Navigator)
19412632 Caspase 8 was not associated with any stages of bladder cancer.
19412632 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19372376 Includes the study of a polymorphic upstream ORF in this gene, and shows that it functions to reduce protein levels by ~31%
19345995 Caspase 8 is activated in villous cytotrophoblasts just prior to fusion of these cells and escorts the nuclei from the mononucleated to the syncytial state.
19318553 Authors identified a four-SNP haplotype in the caspase-8 gene that was significantly associated with breast cancer
19318553 Observational study of gene-disease association. (HuGE Navigator)
19289465 TRAIL- and troglitazone-induced apoptosis was preceded by a cleavage of beta-catenin, which was complete in a fully apoptotic population, and was mediated by caspases-3 and -8.
19276244 results suggested that the CASP8 -652 6N ins/del polymorphism is involved in etiology of bladder cancer and thus may be a marker for genetic susceptibility to bladder cancer in Chinese populations
19276244 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19275586 Caspase-8 and caspase-3 activity are required for HIV-1 Vpu-induced cleavage of IRF3 and HIV-1 infection also induces caspase-mediated IRF3 cleavage
19275584 Caspase-8 and caspase-3 activity are required for HIV-1 Vpu-induced cleavage of IRF3 and HIV-1 infection also induces caspase-mediated IRF3 cleavage
19269008 Observational study of gene-disease association. (HuGE Navigator)
19260109 CpG island hypermethylation of caspase-8 is associated with neuroblastoma.
19258216 The study conclude that the frequency of CASP8 gene methylation in cervical cancer is rare and have no any critical role in development of cervical cancer.
19239323 beta-arrestin2 inhibits opioid-induced breast cancer cell death through Akt and caspase-8 pathways.
19219602 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19214744 the CASP8 D302H polymorphism diminishes the high risk of breast cancer conferred by BRCA1 and BRCA2 mutations
19214744 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19214542 CD133+ stem-cell-like glioblastoma cells (SCG) were completely resistant towards treatment with TRAIL; SCGs exhibited only low levels of caspase-8 mRNA and protein; up-regulation of caspase-8 was not sufficient to sensitise SCG to TRAIL
19203830 Coding polymorphisms in Casp5, Casp8 and DR4 genes may play a role in predisposition to lung cancer.
19203830 Observational study of gene-disease association. (HuGE Navigator)
19170196 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19166881 the effect of the ectopic expression of the human initiator caspases-8 in Saccharomyces cerevisiae
19160091 Reduction in caspase 8 expression due to methylation is associated with bladder cancer.
19152111 TNFalpha triggers both caspase 8-dependent and -independent cell death pathways in macrophages and identify a novel mechanism by which A20 protects these cells against both pathways.
19141860 Observational study of gene-disease association. (HuGE Navigator)
19125371 Caspase-8 and caspase-3 activity are required for HIV-1 Vpu-induced cleavage of IRF3 and HIV-1 infection also induces caspase-mediated IRF3 cleavage
19124506 Observational study of gene-disease association. (HuGE Navigator)
19122169 Caspase-8 is involved in neovascularization-promoting progenitor cell functions.
19115040 These data suggest caspase 8, but not cFLIP, activation induced by C5a leads to cell death if protein synthesis of antiapoptotic protein(s) is blocked.
19112091 Retinoic acid-mediated cleavage of procaspase-8 occurred very early and before procaspase-3 cleavage, suggesting that RA might act at the level of the Fas death-inducing signaling complex (DISC).
19111387 caspase-8 presents a promising target to restore defective apoptosis programs in cancers
19094228 Observational study of gene-disease association. (HuGE Navigator)
19074885 Observational study of gene-disease association. (HuGE Navigator)
19048627 inhibition of caspase-8 by siRNA knockdown partially rescues the apoptotic effects of TGFbeta1, suggesting a role for death receptor signaling components in TGFbeta-mediated death of prostate epithelial cells
19048023 This work was carried out to examine the role of MAT II activity and S-adenosylmethionine biosynthesis in the survival of leukemic T cells.
19013323 Caspase-8 and caspase-3 activity are required for HIV-1 Vpu-induced cleavage of IRF3 and HIV-1 infection also induces caspase-mediated IRF3 cleavage
19001123 Cardiolipin provides an anchor and activating platform for caspase-8 translocation to, and embedding in, the mitochondrial membrane, where it oligomerizes and is further activated, steps that are necessary for an efficient type II apoptotic response.
18974049 caspase 8 has a role as a modulator of p85alpha Rab5-GAP activity and endosomal trafficking
18840411 an apoptotic inhibitory complex comprised of DR5, FADD, caspase-8, and c-FLIP(L) exists in MCF-7 cells, and the absence of c-FLIP(L) from this complex induces DR5- and FADD-mediated caspase-8 activation in the death inducing signaling complex
18823701 analysis of CASP8 D302H role in risk of meningioma
18823701 Observational study of gene-disease association. (HuGE Navigator)
18823309 Two single nucleotide polymorphisms (SNPs) in CASP8 were found to be associated with asthma, predominately in Non-Hispanic white's. One SNP was modestly associated with asthma in the African-American and Hispanic populations.
18823309 Observational study of gene-disease association. (HuGE Navigator)
18796435 unique effect of inhibition of fatty-acid synthase results from negative regulation of the mTOR pathway via DDIT4
18728974 The authors conclude that IFNgamma can sensitize SH-SY5Y cells to Adriamycin-, TNFalpha-, and TRAIL-induced apoptosis and this may be realized by the upregulation of caspase 8
18725521 caspase-8 has a role in the production of biologically active IL-1beta in response to TLR3 and TLR4 stimulation
18716417 Caspase-8 expression was up-regulated in rectal adenomas
18691973 Caspase-8 undergoes limited activation upon antigenic stimulation, and this activation is dependent on the paracaspase MALT1.
18684943 Self-processing of activated caspase-8 transgene is differentially involved in its variious enzymatic functions: it is needed for induction of cell death through the extrinsic cell death pathway but not for non-apoptotic functions of caspase-8.
18676836 activity is regulated by MUC1
18676680 Observational study of gene-disease association. (HuGE Navigator)
18675369 Data show that caspase-8 participates in an anoikis-inducing process in MG-63 cells at an early time, and overexpression of Bcl-2 blocks activation of caspase-8 making MG-63 cells anoikis resistant.
18632964 These results illustrate that JEV infection triggers caspase cascades involving the initiators caspase-8 and -9, probably through FADD-independent but mitochondrion-dependent pathways.
18617900 The location of active caspase-8 may profoundly influence its functional capacity as a regulator of either cell cycling or cell death.
18603835 cFLIP is an essential pro-survival factor for granulosa cells, and it prevents granulosa cell apoptosis by inhibiting procaspase-8 activation.
18596409 we report the production of full-length procaspase-8 and show that it is activated by adding the Fas death domain (Fas-DD) and the FADD forming the cytoplasmic part of the death-inducing signaling complex
18563783 Multivariate logistic regression analysis revealed that CASP8 D302 H, CASP8 -652 6N del, and CASP10 I522L were independent risk factors for cutaneous melanoma.
18563783 Observational study of gene-disease association. (HuGE Navigator)
18516683 the balance between antiapoptotic ARC and proapoptotic caspase-8 is the only one to be disturbed during carcinogenesis and tumour progression of renal cell carcinomas
18485876 These findings revealed that TNF-alpha is able to induce apoptosis via two distinct caspase-8 activation pathways that are differentially regulated by cIAP1/2 and c-FLIP.
18483392 genetic variations in the death pathway genes FasL and CASP8 are involved in susceptibility to developing pancreatic cancer.
18483392 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
18473402 The positive expression rates of Fas, caspase-8 and caspase-3 in somatostatin high and moderate expression groups were higher than that in low expression group.
18458084 Caspase-8 cleaves histone deacetylase 7 and abolishes its transcription repressor function.
18431743 Meta-analysis of gene-disease association. (HuGE Navigator)
18398042 Observational study of gene-disease association. (HuGE Navigator)
18381704 Observational study of gene-disease association. (HuGE Navigator)
18362937 CASP8 variants D302H and -652 6N ins/del do not influence the risk of colorectal cancer in the United Kingdom population.
18362937 Observational study of gene-disease association. (HuGE Navigator)
18343995 the -652 6N del polymorphism of CASP8 was associated with age at diagnosis in familial breast cancer cases.This polymorphism may have an effect in postponing the breast cancer onset in predisposed individuals.
18324486 Our findings suggest that the changes in the expression of apoptotic proteins (Fas/FasL and caspase 8) in the thyroid gland of patients with autoimmune Graves Disease and Hashimoto's thyroiditis reflect their involvemetn in the pathogenesis.
18305469 Observational study of gene-disease association. (HuGE Navigator)
18216014 identify a novel mechanism by which caspase 8 is recruited to the lamella of a migrating cell, promoting cell migration independent of its protease activity
18161513 Sulfur mustard caused apoptosis in respiratory tract basal epithelial cells by a caspase-8-mediated pathway.
18158779 Caspase-8 protein expression is uniformly negative among patients with primary osteosarcoma.
18097748 the six-nucleotide deletion in CASP8 promoter does not have a role in susceptibility to breast and prostate cancers in the Polish population
18089800 Association of caspase-8 and Src may help reconcile why a potential tumor suppressor such as caspase-8 is rarely absent in cancers.
18089778 aspase-8 phosphorylation converts it from a proapoptotic factor to a cell motility factor that interacts with the p85 subunit of phosphatidylinoitol 3-kinase a cell migrtion component.
18086677 Thus the phosphorylation and dephosphorylation of caspase-8, mediated by Lyn and SHP-1, respectively, represents a novel, dynamic post-translational mechanism for the regulation of neutrophil apoptosis
18076022 Proteasome inhibition can sensitize cells to apoptosis elicited by tumor necrosis factor ligands and retarding caspase-8 degradation provides one explanation for this activity.
18054197 Enteropathogenic Escherichia coli induced apoptosis in T84 intestinal epithelial cells via induction of caspases-3, -8, and -9.
18045865 CD95L initiates a rapid caspase 8-dependent endosomal acidification
17940865 the CASP8 5'-UTR C > T are associated with breast cancer risks and the effect may be modified by estrogen and progesterone receptor status
17940865 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17932347 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17911615 Transgenic FADD/caspase-8 play an essential role in maintaining S6 kinase activity during T cell cycle progression.
17891485 CASP8 -652 6N del variant has no significant effect on breast cancer risk in Europeans.
17891485 Observational study of gene-disease association. (HuGE Navigator)
17726263 Caspase-8 and cFLIP are upregulated during colorectal carcinogenesis.
17684142 Observational study of gene-disease association. (HuGE Navigator)
17666167 Impaired kinetics of Bax-GFP and Smac/DIABLO-GFP in caspase 8 and bid-silenced and Bcl-2-overexpressed breast cancer cells exposed to camptothecin.
17653867 Caspase-8 and caspase-3 activity are required for HIV-1 Vpu-induced cleavage of IRF3 and HIV-1 infection also induces caspase-mediated IRF3 cleavage
17627287 HIPK2-induced p53Ser46 phosphorylation activates the KILLER/DR5-mediated caspase-8 extrinsic apoptotic pathway.
17626072 Bortezomib induced apoptosis of EBV lymphoblastoid cell lines (LCLs) by inducing cleavage of caspases 8 and 9
17623017 identification of a novel function of HIPPI; it binds to specific upstream sequences of the caspase-1, caspase-8 and caspase-10 genes and alters the expression of the genes
17616526 RbAp48-mediated transformation of HPV16 is probably because of the regulation by RbAp48 of tumor suppressors retinoblastoma and p53, apoptosis-related enzymes caspase-3 and caspase-8, E6, E7, cyclin D1 (CCND1), and c-MYC.
17585337 These findings suggest a novel model for the regulation of caspase-8 during Mn(2+)-induced apoptosis based on the sequential activation of p38 MAPK, MSK1, caspase-8 and mitochondria, respectively.
17572490 In short term blast lines from patients with AML, additive effects of IFN-alpha and LPS on Caspase-8 dependent apoptosis was observed only with few samples
17545522 CASP8, DCR2, and HIN-1 methylation leads to progression of neuroblastoma
17534194 Observational study of gene-disease association. (HuGE Navigator)
17532763 observation indicates that neither CASP7 nor CASP8 mutation may occur in gastrointestinal lymphomas, and suggests that neither of them may play an important role in the development of gastrointestinal lymphomas
17525260 Data suggest that interferon-gamma sensitizes resistant Ewing's sarcoma cells to TRAIL-induced apoptosis by up-regulation of caspase-8 without altering chemosensitivity.
17488272 Caspase-8 and caspase-3 activity are required for HIV-1 Vpu-induced cleavage of IRF3 and HIV-1 infection also induces caspase-mediated IRF3 cleavage
17450141 Observational study of gene-disease association. (HuGE Navigator)
17450141 A six-nucleotide insertion-deletion polymorphism in the CASP8 promoter is associated with susceptibility to multiple cancers.
17442709 Caspase-8 and caspase-3 activity are required for HIV-1 Vpu-induced cleavage of IRF3 and HIV-1 infection also induces caspase-mediated IRF3 cleavage
17436592 A 1.5 foldincrease in caspase-8 activity was observed in cells treated with TAC-101 colon cancer cells in comparison to the control cells.
17378240 upregulation of important elements of apoptosis at mRNA level of FLICE in acute lymphoblastic leukemia cells after CD40 ligation.
17337451 critical role of caspase 8 in the processing of CSN6.
17314102 MADD has a role in the control of cancer cell survival/death as a negative regulator of caspase-8 and confers significant resistance to TRAIL-induced apoptosis
17293864 Observational study of gene-disease association. (HuGE Navigator)
17293864 CASP8 variant is associated with breast cancer risk.
17290218 Death effector domain DEDa, a self-cleaved product of caspase-8/Mch5, translocates to the nucleus by binding to ERK1/2 and upregulates procaspase-8 expression via a p53-dependent mechanism.
17272309 Hypermethylation of the pro-apoptotic CASP8 is a differential feature of glioblastoma multiforme relapses.
17224200 P60-c-src suppresses apoptosis through inhibition of caspase 8 activation in hepatoma cells.
17182797 Caspase-8 inhibition attenuated the 3,3'-Diindolylmethane-induced apoptosis, indicating that increased activation of this enzyme contributed to the increase in apoptosis in colon cancer cells.
17170703 caspase-8 regulates androgen-receptor-driven gene expression
17071630 Observational study of gene-disease association. (HuGE Navigator)
17064406 Promoter hypermethylation of CASP8 occurs at a high frequency in neuroblastomas.
17047155 identify a role for caspase-8 in monocytes undergoing macrophagic differentiation, that is, the enzyme activated in an atypical complex down-regulates NF-kappaB activity through RIP1 cleavage.
17030903 BMPs promote apoptotic cell death in normal human pulmonary artery smooth muscle cells (PASMCs) by activation of caspases-3, -8, and -9, cytochrome c release, and downregulation of Bcl-2
17018785 Observational study of gene-disease association. (HuGE Navigator)
16951203 Flavopiridol downregulates FLICE proteins and sensitizes breast tumor cell lines.
16938569 Observational study of gene-disease association. (HuGE Navigator)
16938569 Polymorphisms and their haplotypes in the CASP-8 gene can result in alterations in CASP-8 expression and/or activity, thereby modulating the susceptibility to lung cancer.
16886176 Caspase-8 levels correlate with the expression of signal transducer and activator of transcription 1 in high-grade neuroblastoma
16762833 The identification of a procaspase-specific binding surface on the FADD DED suggests a preferential interaction with one, but not both, of the DEDs of procaspase-8 in a perpendicular arrangement.
16733806 caspase-8 can be involved in the control of IkappaBalpha level
16722146 plays an important role in chemoresistance against genotoxic drugs
16636047 caspases were specifically involved in the differentiation of peripheral blood monocytes into macrophages while not required for monocyte differentiation into dendritic cells
16633737 overexpressed hER-beta but not hER-alpha may induce caspase-8-mediated apoptosis by increasing the hTNF-alpha gene expression in a ligand-dependent manner in poorly differentiated HA22T cells
16619028 Src activation triggers Caspase-8 phosphorylation on Tyr380 and impairs Fas-induced apoptosis.
16607283 Decitabine and IFN-gamma at relatively low individual concentrations cooperate to restore caspase-8 expression and sensitize resistant neuroblastoma and medulloblastoma cells to TRAIL-induced apoptosis.
16556893 Caspase-9 knock-out cells were resistant, while caspase-8-deficient cells were sensitive to triptolide, suggesting criticality of the mitochondrial but not the death receptor pathway for triptolide-induced apoptosis.
16541419 caspase 8 expression levels were as DR5 directly correlated to TRAIL sensitivity in prostate tumor cells
16538383 These findings reveal that prolonged ERK1-2/MAPK stimulation results in FADD-independent caspase 8 activation and cell death.
16528386 Transfection of the human papillomavirus (HPV) 16 E6 oncogene into HCT116 cells provides protection from tumor necrosis factor-related apoptosis inducing ligand (TRAIL)-mediated apoptosis.
16478725 Mcl-1 may serve as a direct substrate for TRAIL-activated caspases implying the existence of a novel TRAIL/caspase-8/Mcl-1/Bim communication mechanism between the extrinsic and the intrinsic apoptotic pathways
16446372 in cells where pro-caspase-8 is not activated, TNFalpha + cycloheximide can initiate apoptosis through lysosomal disruption and aryl hydrocarbon receptor modulation
16436380 TRAF6 regulates cell fate decisions by inducing caspase 8-dependent apoptosis and the activation of NF-kappaB
16397500 findings define caspase-8 as a metastasis suppressor gene that, together with integrins, regulates the survival and invasive capacity of neuroblastoma cells
16374545 the caspase 8l isoform is present in neuroblastoma and appears to be associated with undifferentiated cell lines and tumors
16251207 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
16251207 significant association seen between number of variant alleles I410 and H302 and highly decreased familial BC risk, pointing to interaction between CASP10 and CASP8 polymorphisms in breast carcinogenesis
16242324 caspase-3, -8, and -9 activity is enhanced by safrole oxidase in lung cancer cells
16225956 caspase-8 is a target gene of IFNalpha and provide evidence showing that IFNalpha treatment sensitizes cells for apoptosis via enhanced caspase-8 transcription.
16193064 The activated caspase-2 processes procaspase-8 monomers between the large and small subunits, thereby priming cancer cells for TNF-related apoptosis-inducing ligand (TRAIL)-mediated apoptosis.
16186808 caspase-8 and -10, despite having overlapping functions, also have selective substrate cleavage specificities and might thereby exert nonredundant roles in apoptosis signaling
16179941 CAP3 is an intermediate of procaspase-8 processing. A model is proposed for procaspase-8 processing and apoptosis initiation.
16179347 involvement of Fas/caspase 8/caspase 3-dependent signaling in an enucleated cell leading to PS externalization, a central feature of erythrophagocytosis and erythrocyte biology
16135563 results suggest that splitting of BL41-E95-A cells induces de novo synthesis of a protein involved in the activation of casp-6 and casp-8, which cleaves 5-LO.
16036110 accelerated degradation of caspase-8 protein is one of the mechanisms that lead to TRAIL resistance in human tumor cells
15976052 Activation of the extrinsic cell-death pathway, including activation of caspase 8, may underlie the diabetes-associated increase in lactotroph death.
15956881 The majority of Langerhans cell histiocytosis cells express FADD.
15906362 Activated caspase-8 initiates the release of cytochrome c during thymoquine-induced apoptosis, thus offering a potential mechanism for TQ-induced apoptosis in p53-null HL-60 cancer cells.
15849201 acid sphingomyelinase activation within rafts involves a Fas-mediated mechanism dependent upon caspase 8 and FADD
15782135 caspase-8 can be sumoylated at lysine 156, which is associated with the nuclear localization of caspase-8 and does not impair caspase-8 activation
15760909 c-FLIP(L) functions primarily as an inhibitor of death receptor-mediated apoptosis through TRAIL and caspase-8 activation
15746428 caspase-8 deficiency specifically abolishes activation of NF-kappaB after stimulation in T, B & NK cells; recruitment of the IKKalpha, beta complex, its activation & the nuclear translocation of NF-kappaB require activity of full-length caspase-8
15735742 caspase-8L expression might explain constitutive resistance to CD95-mediated apoptosis in CD34+ progenitor cells and might participate in the development of stem cell-derived and other leukemias by providing protection from regulatory apoptosis
15701651 caspase-8 plays an important role in the ASC-mediated NF-kappaB activation and IL-8 production, which actually induces physiologically relevant gene expression
15650242 Caspase-8 is expressed in neuroblastoma
15645452 FADD/caspase-8 pathway induces apoptosis through p53 in human pre-malignant and malignant cells
15640164 the derepression of Rb-E2F-regulated genes leads to apoptosis through inactivation of focal adhesion kinase and activation of caspase-8
15637055 removal of N-terminal domains of Bid by caspase-8 and Mcl-1 by caspase-3 enables the maximal mitochondrial perturbation that potentiates TRAIL-induced apoptosis
15611097 interchain cleavage of caspase-8 in the mitochondrial pathway is sufficient to produce an active enzyme even in the absence of receptor-driven procaspase-8 dimerization
15601643 Observational study of gene-disease association. (HuGE Navigator)
15601643 The reproducible, dose-dependent association of CASP8 D302H with breast cancer indicates the potential importance of inherited variation in the apoptosis pathway in breast cancer susceptibility.
15592525 endogenous caspase-8 mediates tumor necrosis factor-alpha-induced activation of NF-kappaB via FLICE-associated huge protein
15578977 Caspase-8 and caspase-3 activity are required for HIV-1 Vpu-induced cleavage of IRF3 and HIV-1 infection also induces caspase-mediated IRF3 cleavage
15531912 frequently mutated in hepatocellular carcinoma, usually frameshift mutation 1225_1226delTG
15509781 calcium binding mediates regulation of caspase 8 and cell death by ARC
15507484 caspase-8 activation triggers anoikis induced by beta1-integrin blockade in human keratinocytes
15492869 Abnormally expressed in lymphocytes in an autoimmune lymphoproliferative disorder.
15476874 activated by the NS3 protein of Hepatitis C virus, and induces apoptosis in mammalian cells
15473998 These data suggest that increased proneness to caspase activation in lymphocytes could reflect an ongoing systemic response in neurodegenerative disease with pathogenetic implications.
15390286 IFN-gamma caused up-regulation of caspase-8 in all tumor cell lines, but no change in Fas-associated death domain protein or caspase-3.
15389560 TNF-alpha acts to modulate the expression of many genes that favors apoptosis of fibroblastic cells, which is dependent mostly upon signaling through caspase-8
15369772 TRAIL at 500 ng/ml induced significant DNA fragmentation, activation of caspase-8.
15289853 the Caspase 8 gene is methylated and silenced in medulloblastoma
15280356 XEDAR belongs to a novel class of death receptors that lack a discernible death domain but are capable of activating apoptosis in a caspase 8- and FADD-dependent fashion
15262979 caspase-2 and caspase-8 activation have roles in the mitochondrial apoptotic pathway induced by ceramide or etoposide
15254227 activated caspase 8 has a role in cleaving BAP31 and caspase 3 and mediating mitochondrion-endoplasmic reticulum cross talk in etoposide-induced cell death
15210716 apoptosis-associated caspase-8 activation does not require dimerization of zymogens
15205454 caspase-8 and -3 have roles in human mast cell apoptosis induction by Pseudomonas aeruginosa exotoxin A
15159409 results suggest that Fas antigen stimulation not only activates caspase-8, but also a distinct signaling pathway involving protein kinase(s) to induce exposure of the N terminus of Bak protein
15142380 Caspase-8 and caspase-3 activity are required for HIV-1 Vpu-induced cleavage of IRF3 and HIV-1 infection also induces caspase-mediated IRF3 cleavage
15111130 These results suggest that cross-talk between the PKB and caspase-8 pathways may regulate the balance between cell survival and cell death in ECV304.
15069192 Long-term inhibition of CARP expression results in suppression of cancer cell growth, highlighting their importance in tumor cell survival
15067048 The long form of transgenic c-FLIP/FLICE can influence cytokine gene expression to promote T helper type 2 cell-driven allergic reaction, in addition to its traditional role of blocking caspase activation induced by death receptors.
15034549 Hypoxia-induced apoptosis was not affected by lack of caspase-8 or FADD.
15024054 Results demonstrate that FLIP(p43) processed by caspase 8 specifically interacts with TRAF2 and subsequently induces activation of the NF-kappaB signaling pathway.
15015772 Inducible Fadd could induce caspase-8 independent apoptosis in some cells.
14993214 up-regulation of human caspase-8 by interferon-gamma in breast tumor cells requires the induction and action of the transcription factor interferon regulatory factor-1
14991747 caspase-8 levels can influence the requirement for mitochondrial involvement in death receptor apoptotic signaling in glioma ce
14982947 IL-15 does not increase IL-1alpha or IL-1beta production but induces IL-1Ra release, increases myeloid cell differentiation factor-1 stability, decreases the activity of caspase-3 and caspase-8, resulting in an inhibition of vimentin cleavage
14982875 RGDS directly binds and activates caspases 8 and 9, inhibits chemotaxis, and induces apoptosis of HUVECs with a mechanism independent from its antiadhesive effect.
14970175 p38-MAPK can directly phosphorylate and inhibit the activities of caspase-8 and caspase-3 and thereby hinder neutrophil apoptosis, and, in so doing, regulate the inflammatory response.
14701762 engineered a p53-mutant breast cancer cell line, Hs578T, to inducibly express HOXA5. Expression of HOXA5 can induce apoptosis through an apoptotic mechanism mediated by caspases 2 and 8.
14688019 Inactivation of CASP8 by hypermethylation is associated with medulloblastoma pathogenesis
14644092 caspase-8-activation can be accelerated at death receptors
14625033 Lower gene expression of caspase-8 correlates with detectable blood-brain barrier leakage and active inflammation in the brain as reflected by gadolinium-enhancing lesions on MRI.
14584591 caspase 7 and caspase 8, but not caspase 2, are involved in induction of apoptosis by sphingosine
14560027 Data show that in response to cytokines which activate death domain-containing receptors, PAK4 inhibits apoptosis early in the caspase cascade, antagonizing the activation of initiator caspase 8.
14522966 caspase-8- and mitochondria-mediated cell death require suppression of extracellular signal-related kinase and activation of p38 MAPK
13679856 ARK5 suppresses the apoptosis induced by nutrient starvation and death receptors via inhibition of CASP8 activation.
12960156 TNFalpha and caspase 8 play roles in the regulation of MMP1 and MMP9 by interferon gamma
12912912 Enzyme activation of CASP8 involves an alteration in the enzymatic properties of CASP8, while procaspase-8 molecules specifically process one another,mature caspases only cleave effector caspases.
12841868 Caspase 8 expression is an important determinant of the response of neuroblastoma cells to Fas-mediated cell death.
12804595 caspase 8 has an essential role in BID cleavage, in the course of p53-dependent apoptosis triggered by fast neutrons in lymphoid cells
12754217 identified for the first time a predominant role for the caspase-8/Bid pathway in signaling associated with hyperoxic lung injury and cell death in vivo and in vitro
12750404 Caspase-8 and caspase-3 activity are required for HIV-1 Vpu-induced cleavage of IRF3 and HIV-1 infection also induces caspase-mediated IRF3 cleavage
12750393 Caspase-8 and caspase-3 activity are required for HIV-1 Vpu-induced cleavage of IRF3 and HIV-1 infection also induces caspase-mediated IRF3 cleavage
12748179 caspase-8 promoter sustains basal activity through SP1 and ETS-like transcription factors and is up-regulated in a p53-dependent mechanism
12738800 Caspase-8 expression and proteolysis in human brain after severe intracranial hypertension.
12721308 caspase-8 and FADD are obligatory for TNF-mediated apoptosis but are not recruited to a TNF-induced membrane-bound receptor signaling complex; they must be activated elsewhere within the cell
12707329 Caspase 8-mediated cell death is central to the biological control of antigen-independent expansion of recent thymic emigrants from human cord blood.
12700660 Caspase-8 mediates a mitochondrial amplification loop that is required for the optimal release of cytochrome c, mitochondrial permeability shift transition, & cell death during apoptosis induced by treatment with the microtubule-damaging agent paclitaxel.
12700635 caspase 8 has a critical role in apoptosis in the death receptor pathway in small cell lung carcinoma cell lines
12692130 Caspases responsible for parkin cleavage were identified by several experimental paradigms exploring the anti-Fas induced pathway and tnf-alpha pathway.
12668660 CASP8 cleavage product of BAP31 at the endoplasmic reticulum stimulates Ca(2+)-dependent mitochondrial fission, enhancing the release of cytochrome C in response to this initiator caspase.
12646168 caspase 8 induces apoptosis after activation by ASC protein
12620239 single amino acid substitutions at the dimer interface abrogate the activity of caspases-8 and -9
12598529 one or more distinct cellular mechanisms regulate Bid cleavage by caspases 8 and 3 in situ.
12507932 caspase 8 is activated by boswellic acids in an apoptotic cascade
12496482 CASP8 activity is triggered by TRAIL-R1 and TRAIL-R2 and continues to apoptosis.
12496481 Treatment of prostatic cell lines with TRAIL alone resulted in processing of FLIP (cellular) and initiated abortive CASP8 proteolysis.
12404116 Caspase-8 and caspase-3 activity are required for HIV-1 Vpu-induced cleavage of IRF3 and HIV-1 infection also induces caspase-mediated IRF3 cleavage
12393901 caspase 3 activation and apoptosis are blocked by LIGHT protein in hepatocytes
12353035 Pleiotropic defects in lymphocyte activation caused by caspase-8 mutations lead to human immunodeficiency
12215447 Data show that FLIP-L promotes the first proteolytic cleavage of pro-caspase-8, but prevents further cleavage of the proenzyme.
12198154 Caspase-10 can not substitute for caspase-8, as the defect in apoptosis induction observed in caspase-8-deficient cells could not be rescued by overexpression of caspase-10.
12198154 Caspase-10 is recruited to and activated at the native TRAIL and CD95 death-inducing signalling complexes in a FADD-dependent manner but can not functionally substitute caspase-8.
12191471 ARC at threonine 149 is phosphorylated by CK2; this phosphorylation targets ARC to mitochondria; ARC is able to bind to caspase-8 only when it is localized to mitochondria but not to the cytoplasm
12170765 CASP8 may function as a tumor suppressor gene in neuroendocrine lung tumors.
12131184 CCR5 mediates Fas- and caspase-8 dependent apoptosis of both uninfected and HIV infected primary human CD4 T cells
12122017 requirement in Hid-triggered apoptosis
12096338 Caspase-8 and caspase-3 activity are required for HIV-1 Vpu-induced cleavage of IRF3 and HIV-1 infection also induces caspase-mediated IRF3 cleavage
12095993 Caspase-8 and caspase-3 activity are required for HIV-1 Vpu-induced cleavage of IRF3 and HIV-1 infection also induces caspase-mediated IRF3 cleavage
12041673 Sodium salicylate-triggered apoptosis in HL-60 cells depends on caspase-8 activation.
12037669 alteration associated with nodal metastasis in non-small cell lung cancer
12021264 lack of role in caspase-9 activation in Sendai virus-infected cells
11992615 caspase-8 activation is necessary but not sufficient for TRAIL-mediated apoptosis
11877293 Resistance to TRAIL in multiple myeloma cells arises from inhibition at the level of caspase-8 activation. Caspase-8 is the apical caspase of TRAIL signaling in MM cells.
11865194 Activation of caspase-8 is critical for sensitivity to cytotoxic anti-Fas antibody-induced apoptosis
11788820 Results show that pro-apoptotic Hippi-Hip-1 heterodimers can recruit procaspase-8 into a complex of Hippi, Hip-1 and procaspase-8, and launch apoptosis through components of the 'extrinsic' cell-death pathway.
11752160 binding of FADD and caspase-8 to molluscum contagiosum virus MC159 v-FLIP is not sufficient for its antiapoptotic function
11734564 Our data indicate that the activation of caspase-8 at the DISC and hence CD95-mediated apoptosis induction shows a cell-specific requirement for intracellular glutathione
11431480 The activation of caspase-8, but not caspase-9, is necessary for Fas-induced apoptosis. Conversely, caspase-9, but not caspase-8, is important for UV-mediated shrunken morphology and apoptosis progression.
11177389 Caspase-8 and caspase-3 activity are required for HIV-1 Vpu-induced cleavage of IRF3 and HIV-1 infection also induces caspase-mediated IRF3 cleavage
11000244 Caspase-8 and caspase-3 activity are required for HIV-1 Vpu-induced cleavage of IRF3 and HIV-1 infection also induces caspase-mediated IRF3 cleavage
10894160 FADD/MORT1 and caspase-8 are recruited to TRAIL receptors 1 and 2 and are essential for apoptosis mediated by TRAIL receptor 2
10708425 Caspase-8 and caspase-3 activity are required for HIV-1 Vpu-induced cleavage of IRF3 and HIV-1 infection also induces caspase-mediated IRF3 cleavage
10438581 Caspase-8 and caspase-3 activity are required for HIV-1 Vpu-induced cleavage of IRF3 and HIV-1 infection also induces caspase-mediated IRF3 cleavage
9971775 Caspase-8 and caspase-3 activity are required for HIV-1 Vpu-induced cleavage of IRF3 and HIV-1 infection also induces caspase-mediated IRF3 cleavage
9878167 Caspase-8 and caspase-3 activity are required for HIV-1 Vpu-induced cleavage of IRF3 and HIV-1 infection also induces caspase-mediated IRF3 cleavage

AA Sequence

MDFSRNLYDIGEQLDSEDLASLKFLSLDYIPQRKQEPIKDALMLFQRLQEKRMLEESNLSFLKELLFRIN      1 - 70
RLDLLITYLNTRKEEMERELQTPGRAQISAYRVMLYQISEEVSRSELRSFKFLLQEEISKCKLDDDMNLL     71 - 140
DIFIEMEKRVILGEGKLDILKRVCAQINKSLLKIINDYEEFSKERSSSLEGSPDEFSNGEELCGVMTISD    141 - 210
SPREQDSESQTLDKVYQMKSKPRGYCLIINNHNFAKAREKVPKLHSIRDRNGTHLDAGALTTTFEELHFE    211 - 280
IKPHDDCTVEQIYEILKIYQLMDHSNMDCFICCILSHGDKGIIYGTDGQEAPIYELTSQFTGLKCPSLAG    281 - 350
KPKVFFIQACQGDNYQKGIPVETDSEEQPYLEMDLSSPQTRYIPDEADFLLGMATVNNCVSYRNPAEGTW    351 - 420
YIQSLCQSLRERCPRGDDILTILTEVNYEVSNKDDKKNMGKQMPQPTFTLRKKLVFPSD               421 - 479
//

Text Mined References (652)

PMID Year Title
26990987 2016 Co-operative and Hierarchical Binding of c-FLIP and Caspase-8: A Unified Model Defines How c-FLIP Isoforms Differentially Control Cell Fate.
26758508 2016 Novel polymorphisms in caspase-8 are associated with breast cancer risk in the California Teachers Study.
26690594 Polymorphisms in FAS and CASP8 genes may contribute to the development of ALPS phenotype: a study in 25 patients with probable ALPS.
26563540 2015 Excessive TLR9 signaling contributes to the pathogenesis of spontaneous abortion through impairment of Treg cell survival by activation of Caspase 8/3.
26510914 2015 Suppression of death receptor 5 enhances cancer cell invasion and metastasis through activation of caspase-8/TRAF2-mediated signaling.
26468282 2015 The Inflammasome Adaptor ASC Induces Procaspase-8 Death Effector Domain Filaments.
26466953 2015 Internalized Cryptococcus neoformans Activates the Canonical Caspase-1 and the Noncanonical Caspase-8 Inflammasomes.
26437781 2016 A20 targets caspase-8 and FADD to protect HTLV-I-infected cells.
26370846 2016 Molecular basis of death effector domain chain assembly and its role in caspase-8 activation.
26107208 2015 Mutation Analysis of the Dimer Forming Domain of the Caspase 8 Gene in Oral Submucous Fibrosis and Squamous Cell Carcinomas.
26055088 2015 Variation within three apoptosis associated genes as potential risk factors for Achilles tendinopathy in a British based case-control cohort.
26010168 2015 Evolutionary analyses of caspase-8 and its paralogs: Deep origins of the apoptotic signaling pathways.
26003730 2015 Crystal structure of the death effector domains of caspase-8.
25962125 2015 A novel caspase 8 selective small molecule potentiates TRAIL-induced cell death.
25914458 2015 Intestinal genetic inactivation of caspase-8 diminishes migration of enterocytes.
25911380 2015 The seventh zinc finger motif of A20 is required for the suppression of TNF-?-induced apoptosis.
25855521 2015 EphA receptors form a complex with caspase-8 to induce apoptotic cell death.
25855136 2015 New basal cell carcinoma susceptibility loci.
25850729 2015 LFA-1-targeting Leukotoxin (LtxA; Leukothera®) causes lymphoma tumor regression in a humanized mouse model and requires caspase-8 and Fas to kill malignant lymphocytes.
25815518 2015 Synergistic effects of valproic acid and arsenic trioxide on RPMI8226 cells in vitro and the possible underlying mechanisms.
25697054 2015 24(S)-Hydroxycholesterol induces RIPK1-dependent but MLKL-independent cell death in the absence of caspase-8.
25665064 2015 Silver nanoparticles biosynthesized using Achillea biebersteinii flower extract: apoptosis induction in MCF-7 cells via caspase activation and regulation of Bax and Bcl-2 gene expression.
25553350 2014 The relationship of CASP 8 polymorphism and cancer susceptibility: a meta-analysis.
25526311 2014 Dysfunctional HIV-specific CD8+ T cell proliferation is associated with increased caspase-8 activity and mediated by necroptosis.
25502557 2014 CASP8 SNP D302H (rs1045485) is associated with worse survival in MYCN-amplified neuroblastoma patients.
25476903 2014 RIPK1 promotes death receptor-independent caspase-8-mediated apoptosis under unresolved ER stress conditions.
25451151 2015 Novel roles for caspase-8 in IL-1? and inflammasome regulation.
25450619 2015 RIPK3 regulates p62-LC3 complex formation via the caspase-8-dependent cleavage of p62.
25403406 2014 Caspase expression in placental terminal villi in spontaneous and induced pregnancy.
25349431 2014 DICER1/Alu RNA dysmetabolism induces Caspase-8-mediated cell death in age-related macular degeneration.
25347010 2015 Caspase-8 polymorphisms result in reduced Alemtuzumab-induced T-cell apoptosis and worse survival after transplantation.
25292051 2014 Impact of caspase-8 (CASP8) -652 6N del and D302H polymorphisms on prostate cancer in different ethnic groups.
25246614 2014 Casp8p41 generated by HIV protease kills CD4 T cells through direct Bak activation.
25228008 2014 Gefitinib induces cytoplasmic translocation of the CDK inhibitor p27 and its binding to a cleaved intermediate of caspase 8 in non-small cell lung cancer cells.
25214386 2011 Artemisinin induces caspase-8/9-mediated and Bax/Bak-independent apoptosis in human lung adenocarcinoma (ASTC-a-1) cells.
25197060 2014 A TNFSF15 disease-risk polymorphism increases pattern-recognition receptor-induced signaling through caspase-8-induced IL-1.
25189649 2014 The interrelationship between HER2 and CASP3/8 with apoptosis in different cancer cell lines.
25168388 2015 Identification and characterization of novel associations in the CASP8/ALS2CR12 region on chromosome 2 with breast cancer risk.
25132643 2014 Mechanism of 2',3'-dimethoxyflavanone-induced apoptosis in breast cancer stem cells: role of ubiquitination of caspase-8 and LC3.
25129146 2014 Joint analysis of three genome-wide association studies of esophageal squamous cell carcinoma in Chinese populations.
25060909 2014 The caspase-8 shRNA-modified mesenchymal stem cells improve the function of infarcted heart.
25059065 2014 [Soluble apoptosis markers in obese patients with food intolerance].
25043603 2014 Apo2L/TRAIL and the death receptor 5 agonist antibody AMG 655 cooperate to promote receptor clustering and antitumor activity.
24990442 2014 Mitochondrial apoptosis is dispensable for NLRP3 inflammasome activation but non-apoptotic caspase-8 is required for inflammasome priming.
24934366 2014 A novel inflammatory regulator TIPE2 inhibits TLR4-mediated development of colon cancer via caspase-8.
24931006 2014 Caspase-8-mediated PAR-4 cleavage is required for TNF?-induced apoptosis.
24839934 2014 PinX1 without the G-patch motif suppresses proliferation, induces senescence, but does not inhibit telomerase activity in colorectal cancer SW480 cells.
24819879 2014 Identification of a secondary promoter of CASP8 and its related transcription factor PUR?.
24816188 2014 Caspase-8 mutations in head and neck cancer confer resistance to death receptor-mediated apoptosis and enhance migration, invasion, and tumor growth.
24810056 2014 The combination of the prodrugs perforin-CEBPD and perforin-granzyme B efficiently enhances the activation of caspase signaling and kills prostate cancer.
24762656 2014 S-nitrosylation of FLICE inhibitory protein determines its interaction with RIP1 and activation of NF-?B.
24621205 2014 Association of BH3 interacting domain death agonist (BID) gene polymorphisms with proteinuria of immunoglobulin A nephropathy.
24619646 2014 Intra- and interdimeric caspase-8 self-cleavage controls strength and timing of CD95-induced apoptosis.
24589337 2014 Activated neutrophils induce epithelial cell apoptosis through oxidant-dependent tyrosine dephosphorylation of caspase-8.
24561085 2014 Fas, FasL, and cleaved caspases 8 and 3 in glioblastomas: a tissue microarray-based study.
24535941 2014 Functional polymorphisms in apoptosis pathway genes and survival in patients with gastric cancer.
24530529 2014 ATM kinase promotes both caspase-8 and caspase-9 activation during TNF-?-induced apoptosis of HeLa cells.
24503077 2014 The human papillomavirus (HPV) E6 oncoproteins promotes nuclear localization of active caspase 8.
24498403 2014 CASP8 -652 6N del polymorphism contributes to colorectal cancer susceptibility: evidence from a meta-analysis.
24484936 2014 Sequential Cdk1 and Plk1 phosphorylation of caspase-8 triggers apoptotic cell death during mitosis.
24465592 2014 Association between CASP8 -652 6N del polymorphism (rs3834129) and colorectal cancer risk: results from a multi-centric study.
24464182 2014 Caspase8 rs1035142 G>T polymorphism was associated with an increased risk of esophageal cancer in a Chinese population.
24457433 2014 CAS P8 -652 6N del polymorphism and breast cancer risk: a systematic review and meta-analysis.
24442637 2014 A synthetic lethal screen identifies FAT1 as an antagonist of caspase-8 in extrinsic apoptosis.
24438025 2014 Involvement of caspase 8 and c-FLIPL in the proangiogenic effects of the tumour necrosis factor-related apoptosis-inducing ligand (TRAIL).
24412083 2014 Single CpG island methylation is not sufficient to maintain the silenced expression of CASPASE-8 apoptosis-related gene among women with epithelial ovarian cancer.
24398693 2014 The C-terminal domain of the long form of cellular FLICE-inhibitory protein (c-FLIPL) inhibits the interaction of the caspase 8 prodomain with the receptor-interacting protein 1 (RIP1) death domain and regulates caspase 8-dependent nuclear factor ?B (NF-?B) activation.
24391214 2014 A novel mitochondrial MAVS/Caspase-8 platform links RNA virus-induced innate antiviral signaling to Bax/Bak-independent apoptosis.
24390342 2014 Genetics of rheumatoid arthritis contributes to biology and drug discovery.
24342355 2014 pERK 1/2 inhibit Caspase-8 induced apoptosis in cancer cells by phosphorylating it in a cell cycle specific manner.
24209510 2013 Cytosolic and nuclear caspase-8 have opposite impact on survival after liver resection for hepatocellular carcinoma.
24149212 2013 Recurrent patterns of DNA methylation in the ZNF154, CASP8, and VHL promoters across a wide spectrum of human solid epithelial tumors and cancer cell lines.
24127565 2013 Lysosomal exocytosis and caspase-8-mediated apoptosis in UVA-irradiated keratinocytes.
24121507 2013 p62/sequestosome-1 up-regulation promotes ABT-263-induced caspase-8 aggregation/activation on the autophagosome.
24097299 2014 TRAIL negatively regulates VEGF-induced angiogenesis via caspase-8-mediated enzymatic and non-enzymatic functions.
24021263 2013 TRIM13 regulates caspase-8 ubiquitination, translocation to autophagosomes and activation during ER stress induced cell death.
23982205 2013 Maternal hyperglycemia activates an ASK1-FoxO3a-caspase 8 pathway that leads to embryonic neural tube defects.
23921907 2014 Genetic variants in fas signaling pathway genes and risk of gastric cancer.
23844036 2013 Genetic polymorphisms of the CASP8 gene promoter may not be associated with colorectal cancer in Han Chinese from southwest China.
23770605 2013 Genome-wide association study identifies multiple risk loci for chronic lymphocytic leukemia.
23751956 Src-inducible association of CrkL with procaspase-8 promotes cell migration.
23659359 2013 Cancer-associated missense mutations of caspase-8 activate nuclear factor-?B signaling.
23618862 2013 YM155 induces caspase-8 dependent apoptosis through downregulation of survivin and Mcl-1 in human leukemia cells.
23516580 2013 The E. coli effector protein NleF is a caspase inhibitor.
23479148 2013 Association between CASP-8 gene polymorphisms and cancer risk in some Asian population based on a HuGE review and meta-analysis.
23443079 2012 Ginsenoside Rh2 induces human hepatoma cell apoptosisvia bax/bak triggered cytochrome C release and caspase-9/caspase-8 activation.
23434145 2013 Molecular markers of therapeutic resistance in breast cancer.
23418437 2013 Caspase-8 binding to cardiolipin in giant unilamellar vesicles provides a functional docking platform for bid.
23313206 2013 The CASP8 -652 6N insertion/deletion promoter polymorphism is associated with renal cell carcinoma risk and metastasis.
23306557 2013 Caspase-8 cleaves its substrates from the plasma membrane upon CD95-induced apoptosis.
23289213 2012 [Association of polymorphic markers of CASP8, BCL2 and BAX genes with aging and longevity].
23255602 2013 Smad7 protein induces interferon regulatory factor 1-dependent transcriptional activation of caspase 8 to restore tumor necrosis factor-related apoptosis-inducing ligand (TRAIL)-mediated apoptosis.
23244104 2012 Expression of survivin and caspase 3 in oral squamous cell carcinoma and peritumoral tissue.
23230268 2013 Type I interferons induce apoptosis by balancing cFLIP and caspase-8 independent of death ligands.
23185580 2012 In vivo imaging of hierarchical spatiotemporal activation of caspase-8 during apoptosis.
23142077 2012 TRAF2 Sets a threshold for extrinsic apoptosis by tagging caspase-8 with a ubiquitin shutoff timer.
23109891 2012 Ethyl gallate induces apoptosis of HL-60 cells by promoting the expression of caspases-8, -9, -3, apoptosis-inducing factor and endonuclease G.
23096115 2012 The adaptor protein FADD and the initiator caspase-8 mediate activation of NF-?B by TRAIL.
23081800 2013 TNF-? has tropic rather than apoptotic activity in human hematopoietic progenitors: involvement of TNF receptor-1 and caspase-8.
23071110 2012 Protease activity of procaspase-8 is essential for cell survival by inhibiting both apoptotic and nonapoptotic cell death dependent on receptor-interacting protein kinase 1 (RIP1) and RIP3.
22949938 2012 Knockdown of apoptosis repressor with caspase recruitment domain (ARC) increases the sensitivity of human glioma cell line U251MG to VM-26.
22942738 2012 The tricyclodecan-9-yl-xanthogenate D609 triggers ceramide increase and enhances FasL-induced caspase-dependent and -independent cell death in T lymphocytes.
22922291 2012 Tumor necrosis factor ? stimulates Her-2 cleavage by activated caspase-8.
22891283 2012 Vesicles released by activated T cells induce both Fas-mediated RIP-dependent apoptotic and Fas-independent nonapoptotic cell deaths.
22860893 2013 Interleukin-24 mediates apoptosis in human B-cells through early activation of cell cycle arrest followed by late induction of the mitochondrial apoptosis pathway.
22843554 2012 Association between CASP8 and CASP10 polymorphisms and toxicity outcomes with platinum-based chemotherapy in Chinese patients with non-small cell lung cancer.
22820578 2012 [Reduced expression of CASP8 in nasopharyngeal carcinoma and its clinical significance].
22815944 2012 Induction of Fas mediated caspase-8 independent apoptosis in immune cells by Armigeres subalbatus saliva.
22806078 2013 FasL-triggered death of Jurkat cells requires caspase 8-induced, ATP-dependent cross-talk between Fas and the purinergic receptor P2X(7).
22801217 2012 The molecular mechanism of apoptosis upon caspase-8 activation: quantitative experimental validation of a mathematical model.
22691345 2012 [Expression of caspase-8 in non-small cell lung cancer and its role in invasion and metastasis of lung cancer A549 cells].
22683266 2012 A death effector domain chain DISC model reveals a crucial role for caspase-8 chain assembly in mediating apoptotic cell death.
22683265 2012 Stoichiometry of the CD95 death-inducing signaling complex: experimental and modeling evidence for a death effector domain chain model.
22672670 2012 MGMT, GATA6, CD81, DR4, and CASP8 gene promoter methylation in glioblastoma.
22659694 2012 Bi-directional PCR allele-specific amplification (bi-PASA) for detection of caspase-8 -652 6N ins/del promoter polymorphism (rs3834129) in breast cancer.
22644571 2012 Cleavage of Atg3 protein by caspase-8 regulates autophagy during receptor-activated cell death.
22588838 2012 The apoptosis pathway and the genetic predisposition to Achilles tendinopathy.
22528489 2012 Cathepsin D primes caspase-8 activation by multiple intra-chain proteolysis.
22513478 2012 CASP8 -652 6N del polymorphism and cancer risk: a meta-analysis of 30 case-control studies in 50,112 subjects.
22508042 2012 EMT phenotype is induced by increased Src kinase activity via Src-mediated caspase-8 phosphorylation.
22421964 2012 dsRNA induces apoptosis through an atypical death complex associating TLR3 to caspase-8.
22408249 2012 Proteasome inhibition can impair caspase-8 activation upon submaximal stimulation of apoptotic tumor necrosis factor-related apoptosis inducing ligand (TRAIL) signaling.
22383778 2012 Differential effect of intrauterine hypoxia on caspase 3 and DNA fragmentation in fetal guinea pig hearts and brains.
22357491 2011 [Polymorphisms in Fas pathway genes and risk of coal worker pneumoconiosis].
22339913 2011 [Studies on apoptosis and caspase-8 and caspase-9 expressions of bone marrow cells in chronic mountain sickness].
22274400 2012 Pick your poison: the Ripoptosome, a cell death platform regulating apoptosis and necroptosis.
22267217 2012 Dectin-1 is an extracellular pathogen sensor for the induction and processing of IL-1? via a noncanonical caspase-8 inflammasome.
22253841 2012 Stable extracellular RNA fragments of Mycobacterium tuberculosis induce early apoptosis in human monocytes via a caspase-8 dependent mechanism.
22211869 2012 Functional polymorphisms in FAS, FASL and CASP8 genes and risk of childhood acute lymphoblastic leukemia: a case-control study.
22173242 2012 RIP1 is required for IAP inhibitor-mediated sensitization of childhood acute leukemia cells to chemotherapy-induced apoptosis.
22160860 2012 Caspase-8 isoform 6 promotes death effector filament formation independent of microtubules.
22120515 2012 Role of Caspase 8, Caspase 9 and Bcl-2 polymorphisms in papillary thyroid carcinoma risk in Han Chinese population.
22056502 2012 Fine-mapping CASP8 risk variants in breast cancer.
22046053 2012 Caspase-mediated apoptosis of trophoblasts in term human placental villi is restricted to cytotrophoblasts and absent from the multinucleated syncytiotrophoblast.
22037414 2011 Caspase 8 inhibits programmed necrosis by processing CYLD.
22027693 2012 A systems biology approach identifies SART1 as a novel determinant of both 5-fluorouracil and SN38 drug resistance in colorectal cancer.
22010212 2011 Important role of caspase-8 for chemosensitivity of ALL cells.
21988832 2011 Toward an understanding of the protein interaction network of the human liver.
21983787 2011 Genome-wide association study identifies three new melanoma susceptibility loci.
21979465 2012 FADD cleavage by NK cell granzyme M enhances its self-association to facilitate procaspase-8 recruitment for auto-processing leading to caspase cascade.
21868312 2011 [Expression of Caspase-8 and Bcl-2 in the cartilage loose bodies in patients with Kashin-Beck disease].
21865223 2011 Human cell-death-inducing DFF45-like effector C induces apoptosis via caspase-8.
21819468 2012 Caspase-3/caspase-8, bax and bcl2 in pulps of human primary teeth with physiological root resorption.
21816816 2011 Caspase-8-mediated cleavage inhibits IRF-3 protein by facilitating its proteasome-mediated degradation.
21803845 2011 PMLRAR? binds to Fas and suppresses Fas-mediated apoptosis through recruiting c-FLIP in vivo.
21801448 2011 Essential role of caspase-8 in p53/p73-dependent apoptosis induced by etoposide in head and neck carcinoma cells.
21785459 2012 DJ-1 inhibits TRAIL-induced apoptosis by blocking pro-caspase-8 recruitment to FADD.
21785112 2011 The mechanism of neogambogic acid-induced apoptosis in human MCF-7 cells.
21751259 2011 Co-treatment with ginsenoside Rh2 and betulinic acid synergistically induces apoptosis in human cancer cells in association with enhanced capsase-8 activation, bax translocation, and cytochrome c release.
21737330 2011 cIAPs block Ripoptosome formation, a RIP1/caspase-8 containing intracellular cell death complex differentially regulated by cFLIP isoforms.
21724551 2011 In vitro and in vivo selective antitumor activity of a novel orally bioavailable proteasome inhibitor MLN9708 against multiple myeloma cells.
21714991 2011 Polymorphisms in the CASP8 gene and the risk of epithelial ovarian cancer.
21704196 2012 Proliferative versus apoptotic functions of caspase-8 Hetero or homo: the caspase-8 dimer controls cell fate.
21697465 2011 The ribonucleotide reductase R1 subunits of herpes simplex virus 1 and 2 protect cells against poly(I ┬Ě C)-induced apoptosis.
21669575 2011 Hepatocellular carcinoma HepG2 cell apoptosis and caspase-8 and Bcl-2 expression induced by injectable seed extract of Coix lacryma-jobi.
21667042 2011 Low doses of the novel caspase-inhibitor GS-9450 leads to lower caspase-3 and -8 expression on peripheral CD4+ and CD8+ T-cells.
21633787 2011 Polymorphisms in the promoter region of the CASP8 gene are not associated with non-Hodgkin's lymphoma in Chinese patients.
21628531 2011 Inhibition of protein degradation induces apoptosis through a microtubule-associated protein 1 light chain 3-mediated activation of caspase-8 at intracellular membranes.
21625644 2011 Modulation of the CD95-induced apoptosis: the role of CD95 N-glycosylation.
21576355 2011 Squamous cell carcinoma antigen 1 promotes caspase-8-mediated apoptosis in response to endoplasmic reticulum stress while inhibiting necrosis induced by lysosomal injury.
21569377 2011 Mycobacterium tuberculosis-infected human monocytes down-regulate microglial MMP-2 secretion in CNS tuberculosis via TNF?, NF?B, p38 and caspase 8 dependent pathways.
21554547 2011 Guanylate cyclase activator YC-1 enhances TRAIL-induced apoptosis in human epithelial ovarian carcinoma cells via activation of apoptosis-related proteins.
21548803 2011 Evaluation of the effects of the flavonoid apigenin on apoptotic pathway gene expression on the colon cancer cell line (HT29).
21538054 2011 Polymorphisms of caspase 8 and caspase 9 gene and colorectal cancer susceptibility and prognosis.
21525013 2011 TWEAK induces apoptosis through a death-signaling complex comprising receptor-interacting protein 1 (RIP1), Fas-associated death domain (FADD), and caspase-8.
21524651 2011 Caspase-8 cleavage of the interleukin-21 (IL-21) receptor is a negative feedback regulator of IL-21 signaling.
21487429 2011 Drug-induced caspase 8 upregulation sensitises cisplatin-resistant ovarian carcinoma cells to rhTRAIL-induced apoptosis.
21461653 2011 Caspase 8 and caspase 9 gene polymorphisms and susceptibility to gastric cancer.
21458669 2011 NEMO and RIP1 control cell fate in response to extensive DNA damage via TNF-? feedforward signaling.
21454681 2011 Cellular FLICE-inhibitory protein (cFLIP) isoforms block CD95- and TRAIL death receptor-induced gene induction irrespective of processing of caspase-8 or cFLIP in the death-inducing signaling complex.
21444671 2011 Following cytochrome c release, autophagy is inhibited during chemotherapy-induced apoptosis by caspase 8-mediated cleavage of Beclin 1.
21436691 2011 Changes in activities of caspase-8 and caspase-9 in human cervical malignancy.
21426305 2011 Delayed caspase-8 activation and enhanced integrin ?1-activated FAK underpins anoikis in oesophageal carcinoma cells harbouring mt p53-R175H.
21419663 2011 RIG-I RNA helicase activation of IRF3 transcription factor is negatively regulated by caspase-8-mediated cleavage of the RIP1 protein.
21396853 Polymorphisms and haplotypes in caspases 8 and 9 genes and risk for prostate cancer: a case-control study in cohort of North India.
21380726 2011 Different effect of protein kinase B/Akt and extracellular signal-regulated kinase inhibition on trichostatin A-induced apoptosis in epithelial ovarian carcinoma cell lines.
21328377 2011 CASP8 promoter polymorphism is associated with high-risk HPV types and abnormal cytology but not with cervical cancer.
21269460 2011 Initial characterization of the human central proteome.
21248767 2011 TRAIL-induced keratinocyte differentiation requires caspase activation and p63 expression.
21183955 2011 Fis1 and Bap31 bridge the mitochondria-ER interface to establish a platform for apoptosis induction.
21183680 2011 Phosphorylation of caspase-8 (Thr-263) by ribosomal S6 kinase 2 (RSK2) mediates caspase-8 ubiquitination and stability.
21178828 2011 Apoptosis in the sequestrated nucleus pulposus compared to the remaining nucleus pulposus in the same patient.
21166494 2011 Silibinin-induced apoptosis in MCF7 and T47D human breast carcinoma cells involves caspase-8 activation and mitochondrial pathway.
21157428 2011 Caspase-8 and caspase-7 sequentially mediate proteolytic activation of acid sphingomyelinase in TNF-R1 receptosomes.
21153367 2011 Compartmentalization of TNF-receptor 1 signaling: TNF-R1-associated caspase-8 mediates activation of acid sphingomyelinase in late endosomes.
21135236 2010 Development of atopic dermatitis-like skin disease from the chronic loss of epidermal caspase-8.
21107701 2011 The ribonucleotide reductase R1 subunits of herpes simplex virus types 1 and 2 protect cells against TNF?- and FasL-induced apoptosis by interacting with caspase-8.
21104989 2011 Hypermethylation of apoptotic genes as independent prognostic factor in neuroblastoma disease.
21072056 2011 BID is cleaved by caspase-8 within a native complex on the mitochondrial membrane.
21048031 2011 Single nucleotide polymorphisms of matrix metalloproteinase 9 (MMP9) and tumor protein 73 (TP73) interact with Epstein-Barr virus in chronic lymphocytic leukemia: results from the European case-control study EpiLymph.
20978178 2010 Association of the variants CASP8 D302H and CASP10 V410I with breast and ovarian cancer risk in BRCA1 and BRCA2 mutation carriers.
20978129 2010 Activation of caspase-9, but not caspase-2 or caspase-8, is essential for heat-induced apoptosis in Jurkat cells.
20959405 2010 The IFNG (IFN-gamma) genotype predicts cytogenetic and molecular response to imatinib therapy in chronic myeloid leukemia.
20951133 2011 Cellular inhibitor of apoptosis 1 (cIAP-1) degradation by caspase 8 during TNF-related apoptosis-inducing ligand (TRAIL)-induced apoptosis.
20937773 2010 Cdk1/cyclin B1 controls Fas-mediated apoptosis by regulating caspase-8 activity.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20870287 2010 Caspase activation is not required for villous cytotrophoblast fusion into syncytiotrophoblasts.
20855536 2010 Germline variation in apoptosis pathway genes and risk of non-Hodgkin's lymphoma.
20829884 2011 Peroxiredoxin 6 interferes with TRAIL-induced death-inducing signaling complex formation by binding to death effector domain caspase.
20819778 2010 MicroRNA-related genetic variations as predictors for risk of second primary tumor and/or recurrence in patients with early-stage head and neck cancer.
20817393 2013 Caspase-8 as a therapeutic target in cancer.
20811726 2010 Downregulation of active caspase 8 as a mechanism of acquired TRAIL resistance in mismatch repair-proficient colon carcinoma cell lines.
20808443 2010 Analysis of death receptor 5 and caspase-8 expression in primary and metastatic head and neck squamous cell carcinoma and their prognostic impact.
20804486 2011 Influence of caspases 8 and 9 gene promoter polymorphism on prostate cancer susceptibility and early development of hormone refractory prostate cancer.
20802294 2010 Polymorphism in tumor necrosis factor-related apoptosis-inducing ligand receptor 1 is associated with poor viral response to interferon-based hepatitis C virus therapy in HIV/hepatitis C virus-coinfected individuals.
20800603 2010 Investigation of genetic susceptibility factors for human longevity - a targeted nonsynonymous SNP study.
20799830 Single-cell analysis of dihydroartemisinin-induced apoptosis through reactive oxygen species-mediated caspase-8 activation and mitochondrial pathway in ASTC-a-1 cells using fluorescence imaging techniques.
20724831 2010 Autophagic degradation of active caspase-8: a crosstalk mechanism between autophagy and apoptosis.
20702410 2010 The caspase-8 dimerization/dissociation balance is a highly potent regulator of caspase-8, -3, -6 signaling.
20677014 2010 An approach based on a genome-wide association study reveals candidate loci for narcolepsy.
20661084 2010 Polymorphisms in the caspase genes and the risk of lung cancer.
20652397 2011 The CASP8 rs3834129 polymorphism and breast cancer risk in BRCA1 mutation carriers.
20644561 2011 A large-scale candidate gene approach identifies SNPs in SOD2 and IL13 as predictive markers of response to preoperative chemoradiation in rectal cancer.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20616437 2010 Caspase 8 and menin expressions are not correlated in human parathyroid tumors.
20613771 2010 A previously unreported function of ?(1)B integrin isoform in caspase-8-dependent integrin-mediated keratinocyte death.
20606168 2010 Mutant nucleophosmin deregulates cell death and myeloid differentiation through excessive caspase-6 and -8 inhibition.
20605201 2010 Gene-environment interactions in 7610 women with breast cancer: prospective evidence from the Million Women Study.
20572163 2010 Functional polymorphisms in cell death pathway genes and risk of renal cell carcinoma.
20565257 2010 Intracellular Casp8p41 content is inversely associated with CD4 T cell count.
20564345 2010 Caspase-8 polymorphisms and risk of gallbladder cancer in a northern Indian population.
20554749 2010 FGFR2 and other loci identified in genome-wide association studies are associated with breast cancer in African-American and younger women.
20502973 2010 Breast cancer susceptibility variants alter risk in familial ovarian cancer.
20471133 2011 A combination of functional polymorphisms in the CASP8, MMP1, IL10 and SEPS1 genes affects risk of non-small cell lung cancer.
20453000 2010 A Large-scale genetic association study of esophageal adenocarcinoma risk.
20443055 2011 Functional implication of TRAIL -716 C/T promoter polymorphism on its in vitro and in vivo expression and the susceptibility to sporadic breast tumor.
20403046 2010 Epigenetic methylation and expression of caspase 8 and survivin in hepatocellular carcinoma.
20402676 2010 Mutational analysis of caspase genes in prostate carcinomas.
20398055 2010 DNMT1 and DNMT3b silencing sensitizes human hepatoma cells to TRAIL-mediated apoptosis via up-regulation of TRAIL-R2/DR5 and caspase-8.
20379197 2010 Mutant PIK3CA licenses TRAIL and CD95L to induce non-apoptotic caspase-8-mediated ROCK activation.
20363033 2010 Genetic association of CASP8 polymorphisms with primary progressive multiple sclerosis.
20356928 2010 Activity of protein kinase CK2 uncouples Bid cleavage from caspase-8 activation.
20353946 2010 Protein kinase RNA/FADD/caspase-8 pathway mediates the proapoptotic activity of the RNA-binding protein human antigen R (HuR).
20308068 2010 Inducible dimerization and inducible cleavage reveal a requirement for both processes in caspase-8 activation.
20237344 2010 Performance of common genetic variants in breast-cancer risk models.
20198319 2010 Targeted photodynamic therapy for prostate cancer: inducing apoptosis via activation of the caspase-8/-3 cascade pathway.
20176653 2010 CASP8 polymorphisms contribute to cancer susceptibility: evidence from a meta-analysis of 23 publications with 55 individual studies.
20150972 2009 A new caspase-8 isoform caspase-8s increased sensitivity to apoptosis in Jurkat cells.
20145138 2010 Common genetic variants associated with breast cancer and mammographic density measures that predict disease.
20143425 2010 Caspases-2 and -8 are involved in the presenilin1/gamma-secretase-dependent cleavage of amyloid precursor protein after the induction of apoptosis.
20132554 2010 Caspase 8 and maspin are downregulated in breast cancer cells due to CpG site promoter methylation.
20103630 2010 Multivalent DR5 peptides activate the TRAIL death pathway and exert tumoricidal activity.
20087649 2010 The small heat shock protein HspB2 is a novel anti-apoptotic protein that inhibits apical caspase activation in the extrinsic apoptotic pathway.
20086182 2010 The six-nucleotide deletion/insertion variant in the CASP8 promoter region is inversely associated with risk of squamous cell carcinoma of the head and neck.
20080300 2010 Caspase 8 and human villous cytotrophoblast differentiation.
20044137 2010 The paradox of caspase 8 in human villous trophoblast fusion.
20033885 2010 Association of CASP8 D302H polymorphism with reduced risk of aggressive prostate carcinoma.
20033750 2010 Regulation of mRNA caspase-8 levels by anti-nuclear autoantibodies.
20013803 2010 Expression and prognostic significance of APAF-1, caspase-8 and caspase-9 in stage II/III colon carcinoma: caspase-8 and caspase-9 is associated with poor prognosis.
20005201 2010 Nitric oxide and thioredoxin type 1 modulate the activity of caspase 8 in HepG2 cells.
19996275 2009 Angiotensin type 2 receptor-mediated apoptosis of human prostate cancer cells.
19954364 2009 Role of caspase 8 as a determinant in trail sensitivity of neuroblastoma cell lines.
19923319 2010 Rab5 mediates caspase-8-promoted cell motility and metastasis.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19902255 2010 Rubella vaccine-induced cellular immunity: evidence of associations with polymorphisms in the Toll-like, vitamin A and D receptors, and innate immune response genes.
19854135 2009 FLASH, a proapoptotic protein involved in activation of caspase-8, is essential for 3' end processing of histone pre-mRNAs.
19852930 2009 Association of caspase-8 mutation with chemoresistance to cisplatin in HOC313 head and neck squamous cell carcinoma cells.
19843670 2009 Association of breast cancer susceptibility variants with risk of pancreatic cancer.
19826114 2009 Polymorphisms in the CASPASE genes and survival in patients with early-stage non-small-cell lung cancer.
19807657 2009 FoxO3a governs early microglial proliferation and employs mitochondrial depolarization with caspase 3, 8, and 9 cleavage during oxidant induced apoptosis.
19801665 2009 Procaspase 8 and Bax are up-regulated by distinct pathways in Streptococcal pyrogenic exotoxin B-induced apoptosis.
19795398 2010 Association of selected polymorphisms of CCND1, p21, and caspase8 with colorectal cancer risk.
19778795 2009 [Expressions of receptor-interacting protein and caspase-8 in oral squamous cell carcinoma and oral precancerous lesions].
19773279 2009 Association between genetic variants in VEGF, ERCC3 and occupational benzene haematotoxicity.
19770581 2009 Green tea (-)-epigalocatechin-3-gallate inhibits KIT activity and causes caspase-dependent cell death in gastrointestinal stromal tumor including imatinib-resistant cells.
19738422 2009 7-(O)-Carboxymethyl daidzein conjugated to N-t-Boc-hexylenediamine: a novel compound capable of inducing cell death in epithelial ovarian cancer stem cells.
19710364 2009 Mind bomb 1 regulation of cFLIP interactions.
19698994 2009 Aberrant integrin activation induces p38 MAPK phosphorylation resulting in suppressed Fas-mediated apoptosis in T cells: implications for rheumatoid arthritis.
19692168 2010 Genetic susceptibility to distinct bladder cancer subphenotypes.
19684859 2009 RNA silencing of Mcl-1 enhances ABT-737-mediated apoptosis in melanoma: role for a caspase-8-dependent pathway.
19665028 2009 Inhibition of human initiator caspase 8 and effector caspase 3 by cross-class inhibitory bovSERPINA3-1 and A3-3.
19644511 2009 IPS-1 is crucial for DAP3-mediated anoikis induction by caspase-8 activation.
19629679 2010 Association of two CASP8 polymorphisms with breast cancer risk: a meta-analysis.
19625176 2009 PTEN identified as important risk factor of chronic obstructive pulmonary disease.
19617217 2010 Breast cancer susceptibility variants alter risks in familial disease.
19597472 2009 Histone deacetylase inhibitors cooperate with IFN-gamma to restore caspase-8 expression and overcome TRAIL resistance in cancers with silencing of caspase-8.
19593445 2009 Expression of the Bcl-2 protein BAD promotes prostate cancer growth.
19573080 2009 Common genetic variants in candidate genes and risk of familial lymphoid malignancies.
19550122 2009 Caspase-dependent molecular mechanisms of anti-human DR5 monoclonal antibody mDRA-6 inducing apoptosis of human leukemia Jurkat cells.
19543235 2009 Procaspase 8 overexpression in non-small-cell lung cancer promotes apoptosis induced by FLIP silencing.
19542541 2009 Polymorphisms in cell death pathway genes are associated with altered sperm apoptosis and poor semen quality.
19531679 2009 Polymorphisms and haplotypes in the caspase-3, caspase-7, and caspase-8 genes and risk for endometrial cancer: a population-based, case-control study in a Chinese population.
19528225 2009 A new C-terminal cleavage product of procaspase-8, p30, defines an alternative pathway of procaspase-8 activation.
19524513 2009 Phosphorylation-driven assembly of the RIP1-RIP3 complex regulates programmed necrosis and virus-induced inflammation.
19524512 2009 Receptor interacting protein kinase-3 determines cellular necrotic response to TNF-alpha.
19521670 2009 Alternative Fas-mediated cell death pathway is dependent on the different cleavage patterns of procaspase-8.
19493480 2009 [Changes of caspase-8 and caspase-9 activity during apoptosis of keratinocytes induced by trichloroethylene].
19492233 2009 A six-nucleotide insertion-deletion polymorphism in the CASP8 promoter is associated with risk of coal workers' pneumoconiosis.
19470771 2009 Critical role for caspase-8 in epidermal growth factor signaling.
19453261 2009 High-density association study of 383 candidate genes for volumetric BMD at the femoral neck and lumbar spine among older men.
19432816 2010 DR5-mediated DISC controls caspase-8 cleavage and initiation of apoptosis in human glioblastomas.
19427028 2009 Cullin3-based polyubiquitination and p62-dependent aggregation of caspase-8 mediate extrinsic apoptosis signaling.
19414860 2009 Genetic variation in caspase genes and risk of non-Hodgkin lymphoma: a pooled analysis of 3 population-based case-control studies.
19412632 2009 Caspase 9 and caspase 8 gene polymorphisms and susceptibility to bladder cancer in north Indian population.
19372376 2009 Upstream open reading frames cause widespread reduction of protein expression and are polymorphic among humans.
19345995 2009 Fusion of villous trophoblast can be visualized by localizing active caspase 8.
19318553 2009 A breast cancer risk haplotype in the caspase-8 gene.
19289465 2009 Caspase-mediated cleavage of beta-catenin precedes drug-induced apoptosis in resistant cancer cells.
19276244 2009 A six-nucleotide insertion-deletion polymorphism in the CASP8 promoter associated with risk and progression of bladder cancer.
19269008 2009 Mutational analysis of CASP1, 2, 3, 4, 5, 6, 7, 8, 9, 10, and 14 genes in gastrointestinal stromal tumors.
19260109 2009 Detection of CpG island hypermethylation of caspase-8 in neuroblastoma using an oligonucleotide array.
19258216 2009 CpG island methylation of TMS1/ASC and CASP8 genes in cervical cancer.
19240112 2009 Huntingtin promotes cell survival by preventing Pak2 cleavage.
19239323 2009 beta-arrestin2 inhibits opioid-induced breast cancer cell death through Akt and caspase-8 pathways.
19219602 2009 Prostaglandin synthase 2/cyclooxygenase 2 (PTGS2/COX2) 8473T>C polymorphism associated with prognosis for patients with colorectal cancer treated with capecitabine and oxaliplatin.
19214744 2010 CASP8 D302H polymorphism delays the age of onset of breast cancer in BRCA1 and BRCA2 carriers.
19214542 2009 Stem-cell-like glioma cells are resistant to TRAIL/Apo2L and exhibit down-regulation of caspase-8 by promoter methylation.
19203830 2009 Coding polymorphisms in Casp5, Casp8 and DR4 genes may play a role in predisposition to lung cancer.
19176810 2009 The Parkinson disease protein leucine-rich repeat kinase 2 transduces death signals via Fas-associated protein with death domain and caspase-8 in a cellular model of neurodegeneration.
19170196 2009 Polymorphisms in innate immunity genes and lung cancer risk in Xuanwei, China.
19166881 2009 Human initiator caspases trigger apoptotic and autophagic phenotypes in Saccharomyces cerevisiae.
19160091 2009 Methylation patterns of Rb1 and Casp-8 promoters and their impact on their expression in bladder cancer.
19152111 2009 TNFalpha-induced macrophage death via caspase-dependent and independent pathways.
19141860 2009 Genetic variants in the candidate genes of the apoptosis pathway and susceptibility to chronic myeloid leukemia.
19124506 2009 Common genetic variation in candidate genes and susceptibility to subtypes of breast cancer.
19122169 2009 Caspase-8 is involved in neovascularization-promoting progenitor cell functions.
19115040 2009 Activation by C5a of endothelial cell caspase 8 and cFLIP.
19112091 2009 Retinoic acid regulates Fas-induced apoptosis in Jurkat T cells: reversal of mitogen-mediated repression of Fas DISC assembly.
19111387 2009 Caspase-8 in cancer biology and therapy.
19094228 2008 The influence of genetic variation in 30 selected genes on the clinical characteristics of early onset breast cancer.
19074885 2008 Genetic variants in apoptosis and immunoregulation-related genes are associated with risk of chronic lymphocytic leukemia.
19048627 2009 Transforming growth factor beta1 induces apoptosis by suppressing FLICE-like inhibitory protein in DU145 prostate epithelial cells.
19048023 2009 Inhibition of methionine adenosyltransferase II induces FasL expression, Fas-DISC formation and caspase-8-dependent apoptotic death in T leukemic cells.
19001123 2008 Cardiolipin provides an essential activating platform for caspase-8 on mitochondria.
18974049 2008 Caspase 8 promotes peripheral localization and activation of Rab5.
18840411 2008 c-FLIP knockdown induces ligand-independent DR5-, FADD-, caspase-8-, and caspase-9-dependent apoptosis in breast cancer cells.
18823701 2009 CASP8 D302H and meningioma risk: an analysis of five case-control series.
18823309 2008 Association of polymorphisms in CASP10 and CASP8 with FEV(1)/FVC and bronchial hyperresponsiveness in ethnically diverse asthmatics.
18796435 2008 Inhibition of fatty-acid synthase induces caspase-8-mediated tumor cell apoptosis by up-regulating DDIT4.
18728974 2008 Enhanced effect of IFNgamma on the induced apoptosis of neuroblastoma cells by cytotoxic drugs.
18725521 2008 Stimulation of Toll-like receptor 3 and 4 induces interleukin-1beta maturation by caspase-8.
18716417 2008 Clinicopathological significance of caspase-8 and caspase-10 expression in rectal cancer.
18691973 2008 The paracaspase MALT1 controls caspase-8 activation during lymphocyte proliferation.
18684943 2008 Mutation of a self-processing site in caspase-8 compromises its apoptotic but not its nonapoptotic functions in bacterial artificial chromosome-transgenic mice.
18676836 2008 MUC1 oncoprotein blocks death receptor-mediated apoptosis by inhibiting recruitment of caspase-8.
18676680 2008 Pathway-based evaluation of 380 candidate genes and lung cancer susceptibility suggests the importance of the cell cycle pathway.
18675369 2008 Bcl-2 and caspase-8 related anoikis resistance in human osteosarcoma MG-63 cells.
18632964 2008 Japanese encephalitis virus infection activates caspase-8 and -9 in a FADD-independent and mitochondrion-dependent manner.
18617900 2008 Spatial differences in active caspase-8 defines its role in T-cell activation versus cell death.
18603835 2008 cFLIP regulates death receptor-mediated apoptosis in an ovarian granulosa cell line by inhibiting procaspase-8 cleavage.
18596409 2008 In vitro activation of procaspase-8 by forming the cytoplasmic component of the death-inducing signaling complex (cDISC).
18563783 2008 Genetic variants and haplotypes of the caspase-8 and caspase-10 genes contribute to susceptibility to cutaneous melanoma.
18516683 2008 Caspase-8 and its inhibitors in RCCs in vivo: the prominent role of ARC.
18485876 2008 TNF-alpha induces two distinct caspase-8 activation pathways.
18483392 2008 Functional variants in cell death pathway genes and risk of pancreatic cancer.
18473402 2008 Relationship between expression of gastrin, somatostatin, Fas/FasL and caspases in large intestinal carcinoma.
18458084 2008 Caspase-8 cleaves histone deacetylase 7 and abolishes its transcription repressor function.
18455983 2008 TIPE2, a negative regulator of innate and adaptive immunity that maintains immune homeostasis.
18431743 2008 Consortium analysis of 7 candidate SNPs for ovarian cancer.
18398042 2008 The common D302H variant of CASP8 is associated with risk of glioma.
18387192 2008 A pathway sensor for genome-wide screens of intracellular proteolytic cleavage.
18381704 2008 Caspase polymorphisms and genetic susceptibility to multiple myeloma.
18362937 2008 CASP8 variants D302H and -652 6N ins/del do not influence the risk of colorectal cancer in the United Kingdom population.
18343995 2009 Evidences for association of the CASP8 -652 6N del promoter polymorphism with age at diagnosis in familial breast cancer cases.
18328427 2008 Yes and PI3K bind CD95 to signal invasion of glioblastoma.
18324486 2008 Identification of apoptotic proteins in thyroid gland from patients with Graves' disease and Hashimoto's thyroiditis.
18309324 2008 No death without life: vital functions of apoptotic effectors.
18305469 2008 A promoter polymorphism in the CASP8 gene is not associated with cancer risk.
18245485 2008 Inhibition of endoplasmic reticulum stress-induced apoptosis of melanoma cells by the ARC protein.
18216014 2008 Identification of a critical tyrosine residue in caspase 8 that promotes cell migration.
18161513 2008 Sulfur mustard induces apoptosis in cultured normal human airway epithelial cells: evidence of a dominant caspase-8-mediated pathway and differential cellular responses.
18158779 2007 Prognostic value of bax, cytochrome C, and caspase-8 protein expression in primary osteosarcoma.
18097748 2008 A six-nucleotide deletion in the CASP8 promoter is not associated with a susceptibility to breast and prostate cancers in the Polish population.
18089800 2007 Novel noncatalytic role for caspase-8 in promoting SRC-mediated adhesion and Erk signaling in neuroblastoma cells.
18089778 2007 Caspase-8 interacts with the p85 subunit of phosphatidylinositol 3-kinase to regulate cell adhesion and motility.
18086677 2008 Dynamic regulation of neutrophil survival through tyrosine phosphorylation or dephosphorylation of caspase-8.
18076022 2008 Proteasome inhibition blocks caspase-8 degradation and sensitizes prostate cancer cells to death receptor-mediated apoptosis.
18054197 2008 Caspases-3, -8, and -9 are required for induction of epithelial cell apoptosis by enteropathogenic E. coli but are dispensable for increased paracellular permeability.
18045865 2008 Amplification of CD95 activation by caspase 8-induced endosomal acidification in rat hepatocytes.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17940865 2008 CASP8 polymorphisms, estrogen and progesterone receptor status, and breast cancer risk.
17932347 2007 Polymorphisms in apoptosis- and proliferation-related genes, ionizing radiation exposure, and risk of breast cancer among U.S. Radiologic Technologists.
17911615 2007 A Fas-associated death domain protein/caspase-8-signaling axis promotes S-phase entry and maintains S6 kinase activity in T cells responding to IL-2.
17891485 2008 The CASP8 -652 6N del promoter polymorphism and breast cancer risk: a multicenter study.
17726263 2007 Independent induction of caspase-8 and cFLIP expression during colorectal carcinogenesis in sporadic and HNPCC adenomas and carcinomas.
17684142 2007 Polymorphisms in apoptosis and cell cycle control genes and risk of brain tumors in adults.
17666167 2007 Impaired kinetics of Bax-GFP and Smac/DIABLO-GFP in caspase-8- and bid-silenced and Bcl-2 overexpressed breast cancer MCF-7 cells exposed to camptothecin.
17627287 2007 HIPK2-induced p53Ser46 phosphorylation activates the KILLER/DR5-mediated caspase-8 extrinsic apoptotic pathway.
17626072 2007 Bortezomib induces apoptosis of Epstein-Barr virus (EBV)-transformed B cells and prolongs survival of mice inoculated with EBV-transformed B cells.
17623017 2007 Interactions of HIPPI, a molecular partner of Huntingtin interacting protein HIP1, with the specific motif present at the putative promoter sequence of the caspase-1, caspase-8 and caspase-10 genes.
17616526 2007 RbAp48 is a critical mediator controlling the transforming activity of human papillomavirus type 16 in cervical cancer.
17599062 2007 CDIP, a novel pro-apoptotic gene, regulates TNFalpha-mediated apoptosis in a p53-dependent manner.
17585337 2007 p38 MAPK and MSK1 mediate caspase-8 activation in manganese-induced mitochondria-dependent cell death.
17572490 2007 Caspase-8 dependent apoptosis induction in malignant myeloid cells by TLR stimulation in the presence of IFN-alpha.
17545522 2007 Methylation of CASP8, DCR2, and HIN-1 in neuroblastoma is associated with poor outcome.
17534194 2007 Apoptotic gene analysis in idiopathic talipes equinovarus (clubfoot).
17532763 2007 Absence of CASP7 and CASP8 mutation in gastrointestinal lymphomas.
17525260 2007 Interferon-gamma sensitizes resistant Ewing's sarcoma cells to tumor necrosis factor apoptosis-inducing ligand-induced apoptosis by up-regulation of caspase-8 without altering chemosensitivity.
17479112 2007 Ectopic expression of the serine protease inhibitor PI9 modulates death receptor-mediated apoptosis.
17450141 2007 A six-nucleotide insertion-deletion polymorphism in the CASP8 promoter is associated with susceptibility to multiple cancers.
17436592 4- [3,5-bis(trimethylsilyl)benzamido] benzoic acid (TAC-101) induced fas expression and activated caspase-3 and -8 in a DLD-1 colon cancer cell line.
17378240 2007 CD40L and IL-4 stimulation of acute lymphoblastic leukemia cells results in upregulation of mRNA level of FLICE--an important component of apoptosis.
17337451 2007 The subunit CSN6 of the COP9 signalosome is cleaved during apoptosis.
17314102 2007 MADD/DENN splice variant of the IG20 gene is a negative regulator of caspase-8 activation. Knockdown enhances TRAIL-induced apoptosis of cancer cells.
17293864 2007 A common coding variant in CASP8 is associated with breast cancer risk.
17290218 2007 Death effector domain DEDa, a self-cleaved product of caspase-8/Mch5, translocates to the nucleus by binding to ERK1/2 and upregulates procaspase-8 expression via a p53-dependent mechanism.
17272309 2007 CpG island promoter hypermethylation of the pro-apoptotic gene caspase-8 is a common hallmark of relapsed glioblastoma multiforme.
17245429 2007 FLASH links the CD95 signaling pathway to the cell nucleus and nuclear bodies.
17224200 2007 P60-c-src suppresses apoptosis through inhibition of caspase 8 activation in hepatoma cells, but not in primary hepatocytes.
17182797 2007 Activation of caspase-8 contributes to 3,3'-Diindolylmethane-induced apoptosis in colon cancer cells.
17170703 2007 A novel function of caspase-8 in the regulation of androgen-receptor-driven gene expression.
17167422 2007 Hsp70 regulates erythropoiesis by preventing caspase-3-mediated cleavage of GATA-1.
17159907 2007 Palmitoylation of CD95 facilitates formation of SDS-stable receptor aggregates that initiate apoptosis signaling.
17071630 2007 Genetic variants in caspase genes and susceptibility to non-Hodgkin lymphoma.
17064406 2006 Frequent promoter hypermethylation of RASSF1A and CASP8 in neuroblastoma.
17047155 2007 Caspase-8 prevents sustained activation of NF-kappaB in monocytes undergoing macrophagic differentiation.
17030903 2006 BMP-dependent activation of caspase-9 and caspase-8 mediates apoptosis in pulmonary artery smooth muscle cells.
17018785 2006 Commonly studied single-nucleotide polymorphisms and breast cancer: results from the Breast Cancer Association Consortium.
16951203 2006 Flavopiridol induces cellular FLICE-inhibitory protein degradation by the proteasome and promotes TRAIL-induced early signaling and apoptosis in breast tumor cells.
16938569 2006 Polymorphisms in the caspase-8 gene and the risk of lung cancer.
16936772 2007 Integrin-linked kinase interacts with caspase-9 and -8 in an adhesion-dependent manner for promoting radiation-induced apoptosis in human leukemia cells.
16886176 2006 Caspase-8 levels correlate with the expression of signal transducer and activator of transcription 1 in high-grade but not lower grade neuroblastoma.
16762833 2006 The structure of FADD and its mode of interaction with procaspase-8.
16733806 2006 Bortezomib induces in HepG2 cells IkappaBalpha degradation mediated by caspase-8.
16722146 2006 Role of caspase 8 as a determinant in chemosensitivity of p53-mutated head and neck squamous cell carcinoma cell lines.
16636047 2006 Identification of proteins cleaved downstream of caspase activation in monocytes undergoing macrophage differentiation.
16633737 2006 Opposing action of estrogen receptors alpha and beta on tumor necrosis factor-alpha gene expression and caspase-8-mediated apoptotic effects in HA22T cells.
16619028 2006 Src kinase phosphorylates Caspase-8 on Tyr380: a novel mechanism of apoptosis suppression.
16607283 2006 5-Aza-2'-deoxycytidine and IFN-gamma cooperate to sensitize for TRAIL-induced apoptosis by upregulating caspase-8.
16556893 2006 Triptolide induces caspase-dependent cell death mediated via the mitochondrial pathway in leukemic cells.
16541419 2006 Sensitivity of prostate cells to TRAIL-induced apoptosis increases with tumor progression: DR5 and caspase 8 are key players.
16538383 2006 Prolonged activation of ERK1,2 induces FADD-independent caspase 8 activation and cell death.
16528386 2006 Accelerated degradation of FADD and procaspase 8 in cells expressing human papilloma virus 16 E6 impairs TRAIL-mediated apoptosis.
16498403 2006 The role of receptor internalization in CD95 signaling.
16478725 2006 Interrelated roles for Mcl-1 and BIM in regulation of TRAIL-mediated mitochondrial apoptosis.
16446372 2006 Aryl hydrocarbon receptor modulation of tumor necrosis factor-alpha-induced apoptosis and lysosomal disruption in a hepatoma model that is caspase-8-independent.
16436380 2006 TRAF6 regulates cell fate decisions by inducing caspase 8-dependent apoptosis and the activation of NF-kappaB.
16397500 2006 Potentiation of neuroblastoma metastasis by loss of caspase-8.
16374545 2006 Caspase 8L, a novel inhibitory isoform of caspase 8, is associated with undifferentiated neuroblastoma.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16251207 2006 Association of the CASP10 V410I variant with reduced familial breast cancer risk and interaction with the CASP8 D302H variant.
16242324 2006 Safrole oxide induces apoptosis by activating caspase-3, -8, and -9 in A549 human lung cancer cells.
16227629 2005 Molecular determinants of kinase pathway activation by Apo2 ligand/tumor necrosis factor-related apoptosis-inducing ligand.
16225956 2006 Interferon-alpha enhances TRAIL-mediated apoptosis by up-regulating caspase-8 transcription in human hepatoma cells.
16193064 2005 Caspase-2 primes cancer cells for TRAIL-mediated apoptosis by processing procaspase-8.
16186808 2006 Unique and overlapping substrate specificities of caspase-8 and caspase-10.
16183855 2005 Apoptosis induced by a new member of saponin family is mediated through caspase-8-dependent cleavage of Bcl-2.
16179941 2006 The role of CAP3 in CD95 signaling: new insights into the mechanism of procaspase-8 activation.
16179347 2005 Fas-, caspase 8-, and caspase 3-dependent signaling regulates the activity of the aminophospholipid translocase and phosphatidylserine externalization in human erythrocytes.
16169070 2005 A human protein-protein interaction network: a resource for annotating the proteome.
16135563 2005 Caspase-mediated degradation of human 5-lipoxygenase in B lymphocytic cells.
16036110 2005 Accelerated degradation of caspase-8 protein correlates with TRAIL resistance in a DLD1 human colon cancer cell line.
15976052 2005 Activation of caspase 8 in the pituitaries of streptozotocin-induced diabetic rats: implication in increased apoptosis of lactotrophs.
15956881 2005 Immunohistochemical detection of the apoptosis-related proteins FADD, FLICE, and FLIP in Langerhans cell histiocytosis.
15906362 2005 Thymoquinone induces apoptosis through activation of caspase-8 and mitochondrial events in p53-null myeloblastic leukemia HL-60 cells.
15849201 2005 Caspase-dependent and -independent activation of acid sphingomyelinase signaling.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15782135 2005 Caspase-8 sumoylation is associated with nuclear localization.
15760909 2005 Selective knockdown of the long variant of cellular FLICE inhibitory protein augments death receptor-mediated caspase-8 activation and apoptosis.
15746428 2005 Requirement for caspase-8 in NF-kappaB activation by antigen receptor.
15735742 2005 Caspase-8L expression protects CD34+ hematopoietic progenitor cells and leukemic cells from CD95-mediated apoptosis.
15735701 2005 Caspase-9 can antagonize p53-induced apoptosis by generating a p76(Rb) truncated form of Rb.
15701651 2005 ASC-mediated NF-kappaB activation leading to interleukin-8 production requires caspase-8 and is inhibited by CLARP.
15650242 2004 Caspase-8 gene expression in neuroblastoma.
15645452 2005 Selective induction of apoptosis through the FADD/caspase-8 pathway by a p53 c-terminal peptide in human pre-malignant and malignant cells.
15640164 2005 Loss of Rb-E2F repression results in caspase-8-mediated apoptosis through inactivation of focal adhesion kinase.
15637055 2005 Specific cleavage of Mcl-1 by caspase-3 in tumor necrosis factor-related apoptosis-inducing ligand (TRAIL)-induced apoptosis in Jurkat leukemia T cells.
15611097 2005 Caspase-8 can be activated by interchain proteolysis without receptor-triggered dimerization during drug-induced apoptosis.
15601643 2004 Association of a common variant of the CASP8 gene with reduced risk of breast cancer.
15592525 2005 Role of FLASH in caspase-8-mediated activation of NF-kappaB: dominant-negative function of FLASH mutant in NF-kappaB signaling pathway.
15592455 2005 Immunoaffinity profiling of tyrosine phosphorylation in cancer cells.
15531912 2005 Caspase-8 gene is frequently inactivated by the frameshift somatic mutation 1225_1226delTG in hepatocellular carcinomas.
15509781 2004 Calcium binding of ARC mediates regulation of caspase 8 and cell death.
15507484 2004 FLICE/caspase-8 activation triggers anoikis induced by beta1-integrin blockade in human keratinocytes.
15492869 2004 Impaired apoptosis of lymphocytes derived from patient with decreased expression of caspase-8 results in Alps-like phenotype.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15476874 2004 The NS3 protein of hepatitis C virus induces caspase-8-mediated apoptosis independent of its protease or helicase activities.
15473998 2004 Increased caspase activation in peripheral blood mononuclear cells of patients with Alzheimer's disease.
15390286 2004 Interferon-gamma sensitizes osteosarcoma cells to Fas-induced apoptosis by up-regulating Fas receptors and caspase-8.
15389560 2004 TNF-alpha in vivo stimulates apoptosis in fibroblasts through caspase-8 activation and modulates the expression of pro-apoptotic genes.
15369772 2004 Down-regulation of procaspase-8 expression by focal adhesion kinase protects HL-60 cells from TRAIL-induced apoptosis.
15289853 2004 Deletion and aberrant CpG island methylation of Caspase 8 gene in medulloblastoma.
15280356 2004 Induction of apoptosis by X-linked ectodermal dysplasia receptor via a caspase 8-dependent mechanism.
15262979 2004 Sequential caspase-2 and caspase-8 activation upstream of mitochondria during ceramideand etoposide-induced apoptosis.
15254227 2004 Association of active caspase 8 with the mitochondrial membrane during apoptosis: potential roles in cleaving BAP31 and caspase 3 and mediating mitochondrion-endoplasmic reticulum cross talk in etoposide-induced cell death.
15210716 2004 Interchain proteolysis, in the absence of a dimerization stimulus, can initiate apoptosis-associated caspase-8 activation.
15205454 2004 Pseudomonas aeruginosa exotoxin A induces human mast cell apoptosis by a caspase-8 and -3-dependent mechanism.
15159409 2004 A caspase-8-independent signaling pathway activated by Fas ligation leads to exposure of the Bak N terminus.
15111130 2004 Protein kinase B inhibits apoptosis induced by actinomycin D in ECV304 cells through phosphorylation of caspase 8.
15069192 2004 Suppression of caspase-8- and -10-associated RING proteins results in sensitization to death ligands and inhibition of tumor cell growth.
15067048 2004 Cellular FLIP long form-transgenic mice manifest a Th2 cytokine bias and enhanced allergic airway inflammation.
15034549 2004 Molecular ordering of hypoxia-induced apoptosis: critical involvement of the mitochondrial death pathway in a FADD/caspase-8 independent manner.
15024054 2004 N-terminal fragment of c-FLIP(L) processed by caspase 8 specifically interacts with TRAF2 and induces activation of the NF-kappaB signaling pathway.
15015772 2004 Induction of apoptosis in resistant glioma cells by synthetic caspase-activation.
14993214 2004 The up-regulation of human caspase-8 by interferon-gamma in breast tumor cells requires the induction and action of the transcription factor interferon regulatory factor-1.
14991747 2004 Caspase-8 levels affect necessity for mitochondrial amplification in death ligand-induced glioma cell apoptosis.
14982947 2004 Interleukin-15 delays human neutrophil apoptosis by intracellular events and not via extracellular factors: role of Mcl-1 and decreased activity of caspase-3 and caspase-8.
14982875 2004 RGDS peptide induces caspase 8 and caspase 9 activation in human endothelial cells.
14970175 2004 p38-MAPK signals survival by phosphorylation of caspase-8 and caspase-3 in human neutrophils.
14759258 2004 An unappreciated role for RNA surveillance.
14701762 2004 HOXA5-induced apoptosis in breast cancer cells is mediated by caspases 2 and 8.
14688019 2004 Identification of tumour-specific epigenetic events in medulloblastoma development by hypermethylation profiling.
14684825 2003 Genome-wide survey of human alternative pre-mRNA splicing with exon junction microarrays.
14644197 2003 Mechanisms of caspase activation.
14644092 2004 Enhancement of death-receptor induced caspase-8-activation in the death-inducing signalling complex by uncoupling of oxidative phosphorylation.
14625033 2003 Decreased levels of CD95 and caspase-8 mRNA in multiple sclerosis patients with gadolinium-enhancing lesions on MRI.
14612908 2003 Defects in death-inducing signalling complex formation prevent JNK activation and Fas-mediated apoptosis in DU 145 prostate carcinoma cells.
14584591 2003 Functional role of caspases in sphingosine-induced apoptosis in human hepatoma cells.
14560027 2003 Death receptor-induced activation of initiator caspase 8 is antagonized by serine/threonine kinase PAK4.
14522966 2003 Suppression of extracellular signal-related kinase and activation of p38 MAPK are two critical events leading to caspase-8- and mitochondria-mediated cell death in phytosphingosine-treated human cancer cells.
13679856 2003 ARK5 suppresses the cell death induced by nutrient starvation and death receptors via inhibition of caspase 8 activation, but not by chemotherapeutic agents or UV irradiation.
12960156 2003 Interferon-gamma differentially regulates monocyte matrix metalloproteinase-1 and -9 through tumor necrosis factor-alpha and caspase 8.
12912912 2003 Interdimer processing mechanism of procaspase-8 activation.
12888622 2003 Caspase cleavage of tau: linking amyloid and neurofibrillary tangles in Alzheimer's disease.
12887920 2003 Induction of TNF receptor I-mediated apoptosis via two sequential signaling complexes.
12884866 2003 Caspase-8 and caspase-10 activate NF-kappaB through RIP, NIK and IKKalpha kinases.
12841868 2003 Expression of short-form caspase 8 correlates with decreased sensitivity to Fas-mediated apoptosis in neuroblastoma cells.
12804595 2003 Caspase 8-mediated cleavage of the pro-apoptotic BCL-2 family member BID in p53-dependent apoptosis.
12761501 2003 Large-scale identification and characterization of human genes that activate NF-kappaB and MAPK signaling pathways.
12754217 2003 Necrotic cell death in response to oxidant stress involves the activation of the apoptogenic caspase-8/bid pathway.
12750404 2003 Vpr R77Q is associated with long-term nonprogressive HIV infection and impaired induction of apoptosis.
12750393 2003 The mitochondriotoxic domain of Vpr determines HIV-1 virulence.
12748179 2003 The human caspase-8 promoter sustains basal activity through SP1 and ETS-like transcription factors and can be up-regulated by a p53-dependent mechanism.
12738800 2003 Caspase-8 expression and proteolysis in human brain after severe head injury.
12721308 2003 Fas-associated death domain protein and caspase-8 are not recruited to the tumor necrosis factor receptor 1 signaling complex during tumor necrosis factor-induced apoptosis.
12707329 2003 IL-7-regulated homeostatic maintenance of recent thymic emigrants in association with caspase-mediated cell proliferation and apoptotic cell death.
12702723 2003 Fas-associated factor 1, FAF1, is a member of Fas death-inducing signaling complex.
12700660 2003 Paclitaxel-induced apoptosis in BJAB cells proceeds via a death receptor-independent, caspases-3/-8-driven mitochondrial amplification loop.
12700635 2003 Silencing of death receptor and caspase-8 expression in small cell lung carcinoma cell lines and tumors by DNA methylation.
12692130 2003 Caspase-1 and caspase-8 cleave and inactivate cellular parkin.
12668660 2003 Caspase cleavage product of BAP31 induces mitochondrial fission through endoplasmic reticulum calcium signals, enhancing cytochrome c release to the cytosol.
12646168 2003 ASC is an activating adaptor for NF-kappa B and caspase-8-dependent apoptosis.
12620239 2003 A unified model for apical caspase activation.
12598529 2003 Post-translational modification of Bid has differential effects on its susceptibility to cleavage by caspase 8 or caspase 3.
12527898 2003 DEDD and DEDD2 associate with caspase-8/10 and signal cell death.
12507932 2002 Boswellic acids trigger apoptosis via a pathway dependent on caspase-8 activation but independent on Fas/Fas ligand interaction in colon cancer HT-29 cells.
12496482 The FLIP variation on the TRAIL DISC: doxorubicin conducts the swan song.
12496481 Doxorubicin pretreatment sensitizes prostate cancer cell lines to TRAIL induced apoptosis which correlates with the loss of c-FLIP expression.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12438416 2002 A caspase cleavage fragment of p115 induces fragmentation of the Golgi apparatus and apoptosis.
12393901 2002 LIGHT, a member of the tumor necrosis factor ligand superfamily, prevents tumor necrosis factor-alpha-mediated human primary hepatocyte apoptosis, but not Fas-mediated apoptosis.
12353035 2002 Pleiotropic defects in lymphocyte activation caused by caspase-8 mutations lead to human immunodeficiency.
12232792 2002 Caspase-6 is the direct activator of caspase-8 in the cytochrome c-induced apoptosis pathway: absolute requirement for removal of caspase-6 prodomain.
12218097 2002 Mitogen-activated protein kinase/extracellular signal-regulated kinase signaling in activated T cells abrogates TRAIL-induced apoptosis upstream of the mitochondrial amplification loop and caspase-8.
12215447 2002 The long form of FLIP is an activator of caspase-8 at the Fas death-inducing signaling complex.
12198154 2002 Caspase-10 is recruited to and activated at the native TRAIL and CD95 death-inducing signalling complexes in a FADD-dependent manner but can not functionally substitute caspase-8.
12196516 2002 TRAIL receptor and CD95 signal to mitochondria via FADD, caspase-8/10, Bid, and Bax but differentially regulate events downstream from truncated Bid.
12191471 2002 Phosphorylation by protein kinase CK2: a signaling switch for the caspase-inhibiting protein ARC.
12189238 2002 UV-induction of keratinocyte endothelin-1 downregulates E-cadherin in melanocytes and melanoma cells.
12170765 Differential inactivation of caspase-8 in lung cancers.
12131184 2002 CCR5 mediates Fas- and caspase-8 dependent apoptosis of both uninfected and HIV infected primary human CD4 T cells.
12122017 2002 Head involution defective (Hid)-triggered apoptosis requires caspase-8 but not FADD (Fas-associated death domain) and is regulated by Erk in mammalian cells.
12107169 2002 Regulation of Fas-associated death domain interactions by the death effector domain identified by a modified reverse two-hybrid screen.
12107159 2002 Caspase activation of mammalian sterile 20-like kinase 3 (Mst3). Nuclear translocation and induction of apoptosis.
12097160 2002 Monitoring of caspase-8/FLICE processing and activation upon Fas stimulation with novel antibodies directed against a cleavage site for caspase-8 and its substrate, FLICE-like inhibitory protein (FLIP).
12096338 2002 Adenovirus encoding HIV-1 Vpr activates caspase 9 and induces apoptotic cell death in both p53 positive and negative human tumor cell lines.
12095993 2002 HIV-1 Vpr induces apoptosis through caspase 9 in T cells and peripheral blood mononuclear cells.
12065591 2002 Active caspase-8 translocates into the nucleus of apoptotic cells to inactivate poly(ADP-ribose) polymerase-2.
12052891 2002 Caspase processing and nuclear export of CTP:phosphocholine cytidylyltransferase alpha during farnesol-induced apoptosis.
12041673 2002 Sodium salicylate-triggered apoptosis in HL-60 cells depends on caspase-8 activation.
12037669 2002 Alterations of Fas-pathway genes associated with nodal metastasis in non-small cell lung cancer.
12021264 2002 Caspase-8 and Apaf-1-independent caspase-9 activation in Sendai virus-infected cells.
12010809 2002 Characterization of caspase-8L: a novel isoform of caspase-8 that behaves as an inhibitor of the caspase cascade.
11965497 2002 Death effector domain-containing proteins DEDD and FLAME-3 form nuclear complexes with the TFIIIC102 subunit of human transcription factor IIIC.
11933563 2002 [Morphologic findings in chronic abuse of heroin and pervitine].
11917123 2002 The procaspase-8 isoform, procaspase-8L, recruited to the BAP31 complex at the endoplasmic reticulum.
11877293 2002 Intracellular regulation of tumor necrosis factor-related apoptosis-inducing ligand-induced apoptosis in human multiple myeloma cells.
11865194 2002 Activation of caspase-8 is critical for sensitivity to cytotoxic anti-Fas antibody-induced apoptosis in human ovarian cancer cells.
11788820 2002 Recruitment and activation of caspase-8 by the Huntingtin-interacting protein Hip-1 and a novel partner Hippi.
11772515 Tumor necrosis factor-alpha-induced apoptosis in T cells from aged humans: a role of TNFR-I and downstream signaling molecules.
11752160 2002 Binding of FADD and caspase-8 to molluscum contagiosum virus MC159 v-FLIP is not sufficient for its antiapoptotic function.
11751897 2002 Nicotine preconditioning antagonizes activity-dependent caspase proteolysis of a glutamate receptor.
11751056 2001 Serpins and other covalent protease inhibitors.
11741396 2001 Activation of caspase-8 in the Alzheimer's disease brain.
11735112 2001 Alternative splicing of caspase-8 mRNA during differentiation of human leukocytes.
11733517 2002 Inactivation of caspase-8 on mitochondria of Bcl-xL-expressing MCF7-Fas cells: role for the bifunctional apoptosis regulator protein.
11717445 2001 Caspase-10 is an initiator caspase in death receptor signaling.
11683038 2001 In vitro and in vivo transfer of bcl-2 gene into keratinocytes suppresses UVB-induced apoptosis.
11583996 2001 Death receptor recruitment of endogenous caspase-10 and apoptosis initiation in the absence of caspase-8.
11555640 2001 Translation inhibition in apoptosis: caspase-dependent PKR activation and eIF2-alpha phosphorylation.
11514563 2001 Identification of a caspase-9 substrate and detection of its cleavage in programmed cell death during mouse development.
11479289 2001 Caspase-mediated cleavage of the Ca2+/calmodulin-dependent protein kinase-like kinase facilitates neuronal apoptosis.
11437602 2001 [W206R]-procaspase 3: an inactivatable substrate for caspase 8.
11431480 2001 Differential involvement of initiator caspases in apoptotic volume decrease and potassium efflux during Fas- and UV-induced cell death.
11427719 2001 A cytomegalovirus-encoded inhibitor of apoptosis that suppresses caspase-8 activation.
11423904 2001 Caspase cleavage of vimentin disrupts intermediate filaments and promotes apoptosis.
11420686 2001 Exploitation of a non-apoptotic caspase to regulate the abundance of the cdkI p27(KIP1) in transformed lymphoid cells.
11406564 2001 Fas-mediated apoptosis in neuroblastoma requires mitochondrial activation and is inhibited by FLICE inhibitor protein and Bcl-2.
11395500 2001 The death effector domain-associated factor plays distinct regulatory roles in the nucleus and cytoplasm.
11387340 2001 Serum response factor cleavage by caspases 3 and 7 linked to apoptosis in human BJAB cells.
11340079 2001 FLASH coordinates NF-kappa B activity via TRAF2.
11264300 2001 Caspase-8 is an effector in apoptotic death of dopaminergic neurons in Parkinson's disease, but pathway inhibition results in neuronal necrosis.
11260720 2001 Covalent inhibition revealed by the crystal structure of the caspase-8/p35 complex.
11181075 2001 Caspase-cleaved TRAF1 negatively regulates the antiapoptotic signals of TRAF2 during TNF-induced cell death.
11161814 2001 Cloning and characterization of three novel genes, ALS2CR1, ALS2CR2, and ALS2CR3, in the juvenile amyotrophic lateral sclerosis (ALS2) critical region at chromosome 2q33-q34: candidate genes for ALS2.
11102441 2001 Pro-caspase-8 is predominantly localized in mitochondria and released into cytoplasm upon apoptotic stimulation.
11101870 2000 Fas triggers an alternative, caspase-8-independent cell death pathway using the kinase RIP as effector molecule.
11101867 2000 The multifaceted role of Fas signaling in immune cell homeostasis and autoimmunity.
11098060 2001 TRAF1 is a substrate of caspases activated during tumor necrosis factor receptor-alpha-induced apoptosis.
11085743 2000 Initiation of apoptosis by granzyme B requires direct cleavage of bid, but not direct granzyme B-mediated caspase activation.
11048727 2000 The biochemistry of apoptosis.
11002417 2000 Activation of the NF-kappaB pathway by caspase 8 and its homologs.
11000244 2000 Human immunodeficiency virus type 1 Vpr induces apoptosis in human neuronal cells.
10964557 2000 Caspase-8 specificity probed at subsite S(4): crystal structure of the caspase-8-Z-DEVD-cho complex.
10926122 2000 Properties of GST-CALM expressed in E. coli.
10911620 2000 A yeast genetic assay for caspase cleavage of the amyloid-beta precursor protein.
10894160 2000 FADD/MORT1 and caspase-8 are recruited to TRAIL receptors 1 and 2 and are essential for apoptosis mediated by TRAIL receptor 2.
10891503 2000 Identification of the cytolinker plectin as a major early in vivo substrate for caspase 8 during CD95- and tumor necrosis factor receptor-mediated apoptosis.
10860845 2000 Dominant expression of a novel splice variant of caspase-8 in human peripheral blood lymphocytes.
10734073 2000 Identification of caspase 3-mediated cleavage and functional alteration of eukaryotic initiation factor 2alpha in apoptosis.
10716992 2000 BAR: An apoptosis regulator at the intersection of caspases and Bcl-2 family proteins.
10708425 2000 Human immunodeficiency virus type 1 vpr induces apoptosis through caspase activation.
10616217 1999 Apoptosis cascade progresses during turnover of human trophoblast: analysis of villous cytotrophoblast and syncytial fragments in vitro.
10521396 1999 Cleavage of the death domain kinase RIP by caspase-8 prompts TNF-induced apoptosis.
10508785 1999 The atomic-resolution structure of human caspase-8, a key activator of apoptosis.
10508784 1999 The three-dimensional structure of caspase-8: an initiator enzyme in apoptosis.
10493725 1999 Knock-out of the neural death effector domain protein PEA-15 demonstrates that its expression protects astrocytes from TNFalpha-induced apoptosis.
10469173 1999 Changes in nuclear morphology during apoptosis correlate with vimentin cleavage by different caspases located either upstream or downstream of Bcl-2 action.
10442631 1999 PED/PEA-15: an anti-apoptotic molecule that regulates FAS/TNFR1-induced apoptosis.
10438581 1999 Roles of p53 and caspases in the induction of cell cycle arrest and apoptosis by HIV-1 vpr.
10435619 1999 Cleavage and relocation of the tyrosine kinase P59FYN during Fas-mediated apoptosis in T lymphocytes.