Property Summary

NCBI Gene PubMed Count 168
PubMed Score 397.09
PubTator Score 355.55

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
Barrett's esophagus 1.700 2.0e-02
esophageal adenocarcinoma 1.300 2.8e-02
medulloblastoma, large-cell -1.100 8.7e-03
juvenile dermatomyositis 1.148 1.6e-09
intraductal papillary-mucinous carcinoma... 1.700 3.9e-04
intraductal papillary-mucinous neoplasm ... 1.300 1.3e-02
colon cancer -1.100 2.4e-04
pediatric high grade glioma 1.100 6.7e-04
group 4 medulloblastoma -1.500 2.1e-04
lung carcinoma -1.200 7.9e-20
psoriasis 1.100 2.1e-107

 GWAS Trait (1)

Protein-protein Interaction (4)

Gene RIF (97)

PMID Text
26307684 Low expression of CASP7 is associated with non-small cell lung cancer.
26045308 18)F-C-SNAT has significantly increased tumor uptake and significantly increased tumor-to-muscle ratio in a preclinical mouse model of tumor therapy.
25784056 Compared with the TT genotype, the rs10787498GT genotype was associated with an increased cervical cancer risk.
25435190 Centipedegrass extract induces apoptosis through the activation of caspases and the downregulation of PI3K/Akt and MAPK phosphorylation in leukemia cells.
25156550 this report suggests a novel finding that cellular signaling caspase 3/7-PKCdelta-Akt/p38 MAPK is crucial to the repopulation in Panc1 cells after radiotherapy.
24434142 Data show that sangivamycin induced the apoptosis of primary effusion lymphoma (PEL) cells by activating caspase-7 and -9 and suppressed the phosphorylation of Erk1/2 and Akt, thus inhibiting activation of the proteins.
24407236 Phosphorylate caspase-7 bu Src at multiple tyrosine sites enhanced its cellular apoptotic effect.
24040159 Potentially functional polymorphisms in the CASP7 gene contribute to gastric adenocarcinoma susceptibility in an eastern Chinese population.
23979166 Inhibition of activated CASP7 by X-linked inhibitor of apoptosis protein is a potential mechanism by which apoptosis is prevented in those cancer cells deficient in casp3.
23765963 These meta-analysis results demonstrated that CASP-3 and CASP-7 genetic polymorphisms are involved in the pathogenesis of cancer.
23732112 HIV-1 Tat activates caspase 3/7 to induce apoptotic cell death in retinal pigment epithelial cells
23728617 HIV-1 Tat activates caspase 3/7 to induce apoptotic cell death in retinal pigment epithelial cells
23650375 Structural snapshots reveal distinct mechanisms of procaspase-3 and -7 activation.
22986525 showed that CASP7 is downregulated in primary prostate tumors and metastatic lesions across multiple data sets
22584050 XIAP does not function as a NEDD8-E3 ligase for caspase-7 in vivo
22548721 genetic polynorphism is associated with the risk of childhood leukemia
22451931 Cellular expression of caspase-7 lacking the critical lysine residues resulted in less-efficient PARP and p23 cleavage compared with cells expressing the wild-type peptidase.
22441531 Genetic variations of CASP7 may modulate overall survival and progress-free survival of patients with advanced non-small cell lung cancer treated with platinum-based chemotherapy.
22184066 identify serine 118 in the transactivation domain of YY1 as the site of CK2alpha phosphorylation, proximal to a caspase 7 cleavage site
21936563 Caspase-7 cleaves human TERT at residues E286 and D628 as part of the apoptosis pathway in cultured cells.
21555521 highly expressed PAK2 mediates chemotherapeutic resistance in human breast invasive ductal carcinoma by negatively regulating caspase-7 activity
21484410 Cathepsin L is present in the nucleus and regulates the transcription of effector caspases 3 and 7, in a p53 dependent manner.
21157428 Caspase-8 and caspase-7 sequentially mediate proteolytic activation of acid sphingomyelinase in TNF-R1 receptosomes.
21142842 Activation of caspases 3/7 and 9 was detected during study of the mechanism by which amine-modified polystyrene nanoparticles induce cell death in a human brain astrocytoma cell line.
20959405 Observational study of gene-disease association. (HuGE Navigator)
20950443 Sorafenib displays significant antiproliferative effects and induces apoptosis via caspase 3, 7 and PARP in B- and T-lymphoblastic cells
20855536 Observational study of gene-disease association. (HuGE Navigator)
20819778 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20800603 Observational study of gene-disease association. (HuGE Navigator)
20661084 Single Nucleotide Polymorphisms in CASP7 is asspciated with lung cancer.
20661084 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20567846 The RIPK1 and CASP7 polymorphisms can be considered as possible prognostic markers for survival after curative resection in patients with colorectal cancer.
20567846 Observational study of gene-disease association. (HuGE Navigator)
20566630 Human caspase-3 and -7 exhibit differences in protease activity, specific homodimer-forming activity, and three-dimensional structural features, all of which are closely interrelated.
20468060 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20453000 Observational study of gene-disease association. (HuGE Navigator)
20404718 HIV-1 Tat activates caspase 3/7 to induce apoptotic cell death in retinal pigment epithelial cells
20402676 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20159985 caspase 7 cleavage of ORF57 may represent a cellular function against lytic KSHV infection
19996278 Results show that wild-type p53 protects cells from caspases dependent death induced by this therapeutic combination in vitro.
19913121 Observational study of gene-disease association. (HuGE Navigator)
19826114 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19782763 Specifically interfering with caspase-7 activation may hold therapeutic value for the treatment of cancer and inflammatory ailments.
19773279 Observational study of gene-disease association. (HuGE Navigator)
19770576 Data show that sorafenib initiated lethal apoptotic process through the release of cytochrome c and caspase 3/7 activation.
19759058 Specific cleavage by caspase-7 relies on excluding recognition by caspase-3 and not on increasing binding for caspase-7.
19738422 Data show that the N-t-boc-Daidzein induced apoptosis is characterized by caspase activation, XIAP and AKT degradation.
19692467 HIV-1 Tat activates caspase 3/7 to induce apoptotic cell death in retinal pigment epithelial cells
19655254 HIV-1 Tat activates caspase 3/7 to induce apoptotic cell death in retinal pigment epithelial cells
19655253 The current study shows that the executioner caspase-3 and -7 have similar conformations for the unliganded active site as well as the inhibitor-bound active site.
19617626 the calpain-activated form of caspase-7 has unique enzymatic activity, localization, and binding affinity when compared with the caspase-activated form
19605487 there is an an association between HCV core and HAX-1, which promotes 5-FU mediated p53-dependent caspase-7 activation and hepatocyte growth inhibition
19604093 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19581639 Dissecting an allosteric switch in caspase-7 using chemical and mutational probes.
19573080 Observational study of gene-disease association. (HuGE Navigator)
19531679 These findings suggest that genetic variants in caspase-3 and caspase-7 may play a role in endometrial cancer susceptibility.
19531679 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19414860 Observational study of gene-disease association. (HuGE Navigator)
19323650 Results show that caspase 7, as an SREBP-1/2 target, can be induced under mevalonate-restricting conditions, which might help overcome its shortage.
19269008 Observational study of gene-disease association. (HuGE Navigator)
19241192 Modulation of effector caspase-7 cleavage determines response of breast and lung tumor cell lines to chemotherapy.
19219602 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19141860 Observational study of gene-disease association. (HuGE Navigator)
19058873 Observational study of gene-disease association. (HuGE Navigator)
19052714 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19022247 During hypoxia in tube-forming endothelial cells, caspase-7 is responsible for chromatin condensation and nuclear fragmentation while caspase-6 is responsible for DNA ladder formation.
18785314 CASP7 (caspase 7) rs2227309 SNP was not associated with rheuatoid arthritis (RA) in a European Caucasian population. CASP7 isoforms alpha and beta could have an involvement in the apoptosis process in RA
18785314 Observational study of gene-disease association. (HuGE Navigator)
18708163 hMTH1 plays an important role in protecting cells against H(2)O(2)-induced apoptosis via a Noxa- and caspase-3/7-mediated signaling pathway, thus conferring a survival advantage through the inhibition of oxidative-stress-induced DNA damage
18596415 Valosin-containing protein was cleaved by both capspase-7 and caspase-3 in vitro and during apoptosis; degradomic approach to caspase-7 provides new candidate substrates and valuable clues to the specific function of caspase-7 in apoptosis
18521960 study provides evidence that during T cell proliferation the intracellular caspase inhibitor X-linked inhibitor-of-apoptosis protein (XIAP) interacts with caspases-3/-7, thereby blocking their full activation, substrate cleavage, and cell death
18459962 These results revealed that caspase-7 has a novel role during cell cycle progression at mitosis.
18086147 Melatonin maintains mitochondrial membrane potential and attenuates activation of initiator (casp-9) and effector caspases (casp-3/casp-7) and PARP in UVR-exposed HaCaT keratinocytes
18072206 A reticulon protein is identified as one out of a selected number of caspase targets during apoptosis and as a novel substrate for Cdk1 and 2.[
17978580 These data indicate that cytosolic PDI is a substrate of caspase-3 and -7, and that it has an anti-apoptotic action.
17880920 These findings suggest that caspase-7 facilitates the execution of apoptosis through down-regulation of the 26S proteasome, which regulates the turnover of proteins involved in the apoptotic process.
17697120 crystal structures show that the S2 pocket of caspase-7 can accommodate diverse residues
17532763 observation indicates that neither CASP7 nor CASP8 mutation may occur in gastrointestinal lymphomas, and suggests that neither of them may play an important role in the development of gastrointestinal lymphomas
17504820 Observational study of gene-disease association. (HuGE Navigator)
17094969 AIF overexpression specifically resulted in the activation of caspase-7, thereby amplifying the inhibition of protein synthesis including eIF3g cleavage.
17023557 Collectively, these data suggest that cathepsin D activation of caspase 3/7 may be required for inducing one of the death pathways elicited by E. coli.
16918502 Promoters of CASP7 genes are modulated by prohibitin.
16498457 These results demonstrate that SSRP1 degradation during apoptosis is a two-step process coupling caspase cleavage and ubiquitin-dependent proteolysis.
16385451 Observational study of gene-disease association. (HuGE Navigator)
16213496 Caspase 7 activation is a prominent feature in periodontitis-associated tissue injury.
16123041 cleavage of Claspin by caspase-7 inactivates the Chk1 signaling pathway
15511269 caspase-2, -6 and -7 expression in gastric cancer cells is decreased compared to in normal gastric mucosal cells
15033720 Dispensable for the execution of apoptosis in a metastatic melanoma cell line.
14623896 apoptosis was preceded by proteolytic cleavage of caspases 2, 3, and 7, and wild type STAT1 also induced cleavage of caspase 7
14584591 caspase 7 and caspase 8, but not caspase 2, are involved in induction of apoptosis by sphingosine
14583630 caspase-7 is involved earlier than other effector caspases in apoptosis
12970753 our data suggest that the inactivating mutations of the CASPASE-7 gene might lead to the loss of its apoptotic function and contribute to the pathogenesis of some human solid cancers
12824163 the N-peptide of caspase 7 serves to physically sequester the caspase-7 zymogen in a cytosolic location that prevents access by upstream activators
12804035 caspase 9 by itself can activate caspase 7 in the absence of the caspase 3-dependent pathway in TNF-alpha-induced apoptosis
12145703 Pro-CASP7 was detected in mitochondria, cytosol, nucleus, and microsomes of U937 cells. During TPA-induced differentiation, it moved to the mitochondria.

AA Sequence

MADDQGCIEEQGVEDSANEDSVDAKPDRSSFVPSLFSKKKKNVTMRSIKTTRDRVPTYQYNMNFEKLGKC      1 - 70
IIINNKNFDKVTGMGVRNGTDKDAEALFKCFRSLGFDVIVYNDCSCAKMQDLLKKASEEDHTNAACFACI     71 - 140
LLSHGEENVIYGKDGVTPIKDLTAHFRGDRCKTLLEKPKLFFIQACRGTELDDGIQADSGPINDTDANPR    141 - 210
YKIPVEADFLFAYSTVPGYYSWRSPGRGSWFVQALCSILEEHGKDLEIMQILTRVNDRVARHFESQSDDP    211 - 280
HFHEKKQIPCVVSMLTKELYFSQ                                                   281 - 303
//

Text Mined References (177)

PMID Year Title
26307684 2015 MicroRNA-224 is implicated in lung cancer pathogenesis through targeting caspase-3 and caspase-7.
26045308 2015 Preclinical Kinetic Analysis of the Caspase-3/7 PET Tracer 18F-C-SNAT: Quantifying the Changes in Blood Flow and Tumor Retention After Chemotherapy.
25784056 2015 CASP7 variants modify susceptibility to cervical cancer in Chinese women.
25435190 2015 Centipedegrass extract induces apoptosis through the activation of caspases and the downregulation of PI3K/Akt and MAPK phosphorylation in leukemia cells.
25416956 2014 A proteome-scale map of the human interactome network.
25156550 2015 Dying tumor cells stimulate proliferation of living tumor cells via caspase-dependent protein kinase C? activation in pancreatic ductal adenocarcinoma.
24434142 2014 Sangivamycin induces apoptosis by suppressing Erk signaling in primary effusion lymphoma cells.
24407236 2014 Antioxidants decrease the apoptotic effect of 5-Fu in colon cancer by regulating Src-dependent caspase-7 phosphorylation.
24040159 2013 Potentially functional polymorphisms in the CASP7 gene contribute to gastric adenocarcinoma susceptibility in an eastern Chinese population.
23979166 2013 Targeting the XIAP/caspase-7 complex selectively kills caspase-3-deficient malignancies.
23765963 2013 HuGE systematic review and meta-analysis demonstrate association of CASP-3 and CASP-7 genetic polymorphisms with cancer risk.
23650375 2013 Structural snapshots reveal distinct mechanisms of procaspase-3 and -7 activation.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22986525 2013 MicroRNA-106b-25 cluster expression is associated with early disease recurrence and targets caspase-7 and focal adhesion in human prostate cancer.
22584050 2012 X-linked inhibitor of apoptosis protein mediates neddylation by itself but does not function as a NEDD8-E3 ligase for caspase-7.
22561518 2012 Genome-wide association analyses identify 13 new susceptibility loci for generalized vitiligo.
22548721 2012 Association between CASP7 and CASP14 genetic polymorphisms and the risk of childhood leukemia.
22451931 2012 Caspase-7 uses an exosite to promote poly(ADP ribose) polymerase 1 proteolysis.
22441531 2012 Association of CASP7 polymorphisms and survival of patients with non-small cell lung cancer with platinum-based chemotherapy treatment.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
22184066 2012 Phosphorylation of the transcription factor YY1 by CK2? prevents cleavage by caspase 7 during apoptosis.
21936563 2011 The catalytic subunit of human telomerase is a unique caspase-6 and caspase-7 substrate.
21555521 2011 Phosphorylation of caspase-7 by p21-activated protein kinase (PAK) 2 inhibits chemotherapeutic drug-induced apoptosis of breast cancer cell lines.
21484410 2011 Inhibition of cathepsin L lowers the apoptotic threshold of glioblastoma cells by up-regulating p53 and transcription of caspases 3 and 7.
21269460 2011 Initial characterization of the human central proteome.
21157428 2011 Caspase-8 and caspase-7 sequentially mediate proteolytic activation of acid sphingomyelinase in TNF-R1 receptosomes.
21142842 2011 Cationic nanoparticles induce caspase 3-, 7- and 9-mediated cytotoxicity in a human astrocytoma cell line.
20959405 2010 The IFNG (IFN-gamma) genotype predicts cytogenetic and molecular response to imatinib therapy in chronic myeloid leukemia.
20950443 2010 The multikinase inhibitor Sorafenib displays significant antiproliferative effects and induces apoptosis via caspase 3, 7 and PARP in B- and T-lymphoblastic cells.
20855536 2010 Germline variation in apoptosis pathway genes and risk of non-Hodgkin's lymphoma.
20819778 2010 MicroRNA-related genetic variations as predictors for risk of second primary tumor and/or recurrence in patients with early-stage head and neck cancer.
20800603 2010 Investigation of genetic susceptibility factors for human longevity - a targeted nonsynonymous SNP study.
20661084 2010 Polymorphisms in the caspase genes and the risk of lung cancer.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20567846 2011 RIPK1 and CASP7 polymorphism as prognostic markers for survival in patients with colorectal cancer after complete resection.
20566630 2010 Identification of functional regions defining different activity in caspase-3 and caspase-7 within cells.
20468060 2010 Genetic pathway-based hierarchical clustering analysis of older adults with cognitive complaints and amnestic mild cognitive impairment using clinical and neuroimaging phenotypes.
20453000 2010 A Large-scale genetic association study of esophageal adenocarcinoma risk.
20402676 2010 Mutational analysis of caspase genes in prostate carcinomas.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20159985 2010 Caspase-7 cleavage of Kaposi sarcoma-associated herpesvirus ORF57 confers a cellular function against viral lytic gene expression.
19996278 2009 Tumor necrosis factor-related apoptosis-inducing ligand (TRAIL) and paclitaxel have cooperative in vivo effects against glioblastoma multiforme cells.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19826114 2009 Polymorphisms in the CASPASE genes and survival in patients with early-stage non-small-cell lung cancer.
19782763 2010 Caspase-7: a protease involved in apoptosis and inflammation.
19773279 2009 Association between genetic variants in VEGF, ERCC3 and occupational benzene haematotoxicity.
19770576 2009 Sorafenib induces preferential apoptotic killing of a drug- and radio-resistant Hep G2 cells through a mitochondria-dependent oxidative stress mechanism.
19759058 2009 Proteome-wide substrate analysis indicates substrate exclusion as a mechanism to generate caspase-7 versus caspase-3 specificity.
19738422 2009 7-(O)-Carboxymethyl daidzein conjugated to N-t-Boc-hexylenediamine: a novel compound capable of inducing cell death in epithelial ovarian cancer stem cells.
19655253 2009 Conformational similarity in the activation of caspase-3 and -7 revealed by the unliganded and inhibited structures of caspase-7.
19617626 2009 Calpain-1 cleaves and activates caspase-7.
19605487 2009 Hepatitis C virus core protein and cellular protein HAX-1 promote 5-fluorouracil-mediated hepatocyte growth inhibition.
19604093 2009 Genetic polymorphisms, their allele combinations and IFN-beta treatment response in Irish multiple sclerosis patients.
19581639 2009 Dissecting an allosteric switch in caspase-7 using chemical and mutational probes.
19573080 2009 Common genetic variants in candidate genes and risk of familial lymphoid malignancies.
19531679 2009 Polymorphisms and haplotypes in the caspase-3, caspase-7, and caspase-8 genes and risk for endometrial cancer: a population-based, case-control study in a Chinese population.
19414860 2009 Genetic variation in caspase genes and risk of non-Hodgkin lymphoma: a pooled analysis of 3 population-based case-control studies.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19323650 2009 Human caspase 7 is positively controlled by SREBP-1 and SREBP-2.
19269008 2009 Mutational analysis of CASP1, 2, 3, 4, 5, 6, 7, 8, 9, 10, and 14 genes in gastrointestinal stromal tumors.
19241192 2009 Modulation of effector caspase cleavage determines response of breast and lung tumor cell lines to chemotherapy.
19219602 2009 Prostaglandin synthase 2/cyclooxygenase 2 (PTGS2/COX2) 8473T>C polymorphism associated with prognosis for patients with colorectal cancer treated with capecitabine and oxaliplatin.
19141860 2009 Genetic variants in the candidate genes of the apoptosis pathway and susceptibility to chronic myeloid leukemia.
19058873 2009 Polymorphisms in the Caspase7 gene and the risk of lung cancer.
19054851 2008 Human protein factory for converting the transcriptome into an in vitro-expressed proteome,.
19052714 2009 TP53 codon 72 polymorphism associated with prognosis in patients with advanced gastric cancer treated with paclitaxel and cisplatin.
19022247 2009 Possible involvement of caspase-6 and -7 but not caspase-3 in the regulation of hypoxia-induced apoptosis in tube-forming endothelial cells.
18785314 2008 Genetic and expression analysis of CASP7 gene in a European Caucasian population with rheumatoid arthritis.
18708163 2008 hMTH1 depletion promotes oxidative-stress-induced apoptosis through a Noxa- and caspase-3/7-mediated signaling pathway.
18596415 2008 Mining of caspase-7 substrates using a degradomic approach.
18521960 2008 Interaction with XIAP prevents full caspase-3/-7 activation in proliferating human T lymphocytes.
18459962 2008 Possible involvement of caspase-7 in cell cycle progression at mitosis.
18086147 2008 Melatonin maintains mitochondrial membrane potential and attenuates activation of initiator (casp-9) and effector caspases (casp-3/casp-7) and PARP in UVR-exposed HaCaT keratinocytes.
18072206 2007 Phosphorylation-regulated cleavage of the reticulon protein Nogo-B by caspase-7 at a noncanonical recognition site.
17978580 2007 Protein disulfide isomerase is cleaved by caspase-3 and -7 during apoptosis.
17880920 2007 Caspase-7 mediated cleavage of proteasome subunits during apoptosis.
17697120 2007 Plasticity of S2-S4 specificity pockets of executioner caspase-7 revealed by structural and kinetic analysis.
17532763 2007 Absence of CASP7 and CASP8 mutation in gastrointestinal lymphomas.
17504820 2007 Caspase 7 influences susceptibility to rheumatoid arthritis.
17167422 2007 Hsp70 regulates erythropoiesis by preventing caspase-3-mediated cleavage of GATA-1.
17094969 2006 Apoptosis-inducing factor (AIF) inhibits protein synthesis by interacting with the eukaryotic translation initiation factor 3 subunit p44 (eIF3g).
17023557 2007 Aspartic protease and caspase 3/7 activation are central for macrophage apoptosis following infection with Escherichia coli.
16918502 2007 Differential regulation of human YY1 and caspase 7 promoters by prohibitin through E2F1 and p53 binding sites.
16498457 2006 Coupling caspase cleavage and ubiquitin-proteasome-dependent degradation of SSRP1 during apoptosis.
16385451 2006 A scan of chromosome 10 identifies a novel locus showing strong association with late-onset Alzheimer disease.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16213496 2005 Caspase activation is involved in chronic periodontitis.
16123041 2005 Cleavage of claspin by caspase-7 during apoptosis inhibits the Chk1 pathway.
15735701 2005 Caspase-9 can antagonize p53-induced apoptosis by generating a p76(Rb) truncated form of Rb.
15650747 2005 XIAP inhibits caspase-3 and -7 using two binding sites: evolutionarily conserved mechanism of IAPs.
15511269 2004 Loss of caspase-2, -6 and -7 expression in gastric cancers.
15500642 2004 Plakin proteins are coordinately cleaved during apoptosis but preferentially through the action of different caspases.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15200957 2004 Dual role of BRUCE as an antiapoptotic IAP and a chimeric E2/E3 ubiquitin ligase.
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
15033720 2003 Cisplatin-induced apoptosis in melanoma cells: role of caspase-3 and caspase-7 in Apaf-1 proteolytic cleavage and in execution of the degradative phases.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14623896 2004 STAT1-induced apoptosis is mediated by caspases 2, 3, and 7.
14584591 2003 Functional role of caspases in sphingosine-induced apoptosis in human hepatoma cells.
14583630 2004 Caspase-7 gene disruption reveals an involvement of the enzyme during the early stages of apoptosis.
12970753 2003 Inactivating mutations of CASPASE-7 gene in human cancers.
12951057 2003 cDNA microarray analysis of altered gene expression in Ara-C-treated leukemia cells.
12888622 2003 Caspase cleavage of tau: linking amyloid and neurofibrillary tangles in Alzheimer's disease.
12824163 2003 Human caspase-7 activity and regulation by its N-terminal peptide.
12804035 2003 Analysis of a mitochondrial apoptotic pathway using Bid-targeted ribozymes in human MCF7 cells in the absence of a caspase-3-dependent pathway.
12665508 2003 Endoplasmic reticulum chaperone protein GRP78 protects cells from apoptosis induced by topoisomerase inhibitors: role of ATP binding site in suppression of caspase-7 activation.
12586738 2003 The p54 cleaved form of the tyrosine kinase Lyn generated by caspases during BCR-induced cell death in B lymphoma acts as a negative regulator of apoptosis.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12181742 2002 Caspase cleavage of the nuclear autoantigen LEDGF/p75 abrogates its pro-survival function: implications for autoimmunity in atopic disorders.
12145703 2002 Intracellular redistribution of procaspases during TPA-induced differentiation of U937 human leukemic cells.
12107159 2002 Caspase activation of mammalian sterile 20-like kinase 3 (Mst3). Nuclear translocation and induction of apoptosis.
11943137 2002 Coupling endoplasmic reticulum stress to the cell death program: role of the ER chaperone GRP78.
11904443 2002 Dominant-interfering forms of MEF2 generated by caspase cleavage contribute to NMDA-induced neuronal apoptosis.
11859414 2002 Yeast two-hybrid screening using constitutive-active caspase-7 as bait in the identification of PA28gamma as an effector caspase substrate.
11829465 2002 Inhibition of nuclear transport of caspase-7 by its prodomain.
11815631 2002 Caspase-mediated cleavage of the stacking protein GRASP65 is required for Golgi fragmentation during apoptosis.
11802788 2002 The human homologue of the yeast polyubiquitination factor Ufd2p is cleaved by caspase 6 and granzyme B during apoptosis.
11755217 2001 Caspase 7 can cleave tumor necrosis factor receptor-I (p60) at a non-consensus motif, in vitro.
11752425 2001 Structural basis for the activation of human procaspase-7.
11701129 2001 Crystal structure of a procaspase-7 zymogen: mechanisms of activation and substrate binding.
11555640 2001 Translation inhibition in apoptosis: caspase-dependent PKR activation and eIF2-alpha phosphorylation.
11535131 2001 Targeting of the transcription factor Max during apoptosis: phosphorylation-regulated cleavage by caspase-5 at an unusual glutamic acid residue in position P1.
11514563 2001 Identification of a caspase-9 substrate and detection of its cleavage in programmed cell death during mouse development.
11448953 2001 Coupling endoplasmic reticulum stress to the cell death program. Mechanism of caspase activation.
11425872 2001 Apoptotic cleavage of cytoplasmic dynein intermediate chain and p150(Glued) stops dynein-dependent membrane motility.
11423904 2001 Caspase cleavage of vimentin disrupts intermediate filaments and promotes apoptosis.
11399776 2001 Caspase-2-induced apoptosis is dependent on caspase-9, but its processing during UV- or tumor necrosis factor-dependent cell death requires caspase-3.
11387340 2001 Serum response factor cleavage by caspases 3 and 7 linked to apoptosis in human BJAB cells.
11359776 2001 X-linked inhibitor of apoptosis protein (XIAP) inhibits caspase-3 and -7 in distinct modes.
11356849 2001 Effect of mutation and phosphorylation of type I keratins on their caspase-mediated degradation.
11278572 2001 Cdc42 is a substrate for caspases and influences Fas-induced apoptosis.
11257231 2001 Structural basis of caspase inhibition by XIAP: differential roles of the linker versus the BIR domain.
11257230 2001 Structural basis of caspase-7 inhibition by XIAP.
11170436 2001 An anti-apoptotic protein human survivin is a direct inhibitor of caspase-3 and -7.
11084335 2000 ML-IAP, a novel inhibitor of apoptosis that is preferentially expressed in human melanomas.
11058599 2001 Executioner caspase-3, -6, and -7 perform distinct, non-redundant roles during the demolition phase of apoptosis.
11024045 2001 Livin, a novel inhibitor of apoptosis protein family member.
10998058 2000 Caspase-3 mediated cleavage of HsRad51 at an unconventional site.
10791974 2000 Caspase-2 is localized at the Golgi complex and cleaves golgin-160 during apoptosis.
10731697 2000 Caspases cleave the amino-terminal calpain inhibitory unit of calpastatin during apoptosis in human Jurkat T cells.
10675528 2000 Prothymosin alpha fragmentation in apoptosis.
10564664 1999 Caspase-3 and caspase-7 but not caspase-6 cleave Gas2 in vitro: implications for microfilament reorganization during apoptosis.
10469173 1999 Changes in nuclear morphology during apoptosis correlate with vimentin cleavage by different caspases located either upstream or downstream of Bcl-2 action.
10318789 1999 Activation of the apoptotic endonuclease DFF40 (caspase-activated DNase or nuclease). Oligomerization and direct interaction with histone H1.
10200531 1998 Proteolytic cleavage of ras GTPase-activating protein during apoptosis.
10082581 1999 SAG, a novel zinc RING finger protein that protects cells from apoptosis induced by redox agents.
10069390 1999 Identification of caspases that cleave presenilin-1 and presenilin-2. Five presenilin-1 (PS1) mutations do not alter the sensitivity of PS1 to caspases.
9990034 1999 Phosphorylation of presenilin-2 regulates its cleavage by caspases and retards progression of apoptosis.
9922454 1999 Ordering the cytochrome c-initiated caspase cascade: hierarchical activation of caspases-2, -3, -6, -7, -8, and -10 in a caspase-9-dependent manner.
9894612 1998 Calpain activation is upstream of caspases in radiation-induced apoptosis.
9850056 1998 IAP-family protein survivin inhibits caspase activity and apoptosis induced by Fas (CD95), Bax, caspases, and anticancer drugs.
9671712 1998 A cloning method for caspase substrates that uses the yeast two-hybrid system: cloning of the antiapoptotic gene gelsolin.
9607320 1998 Proteolytic cleavage of HsRad51 during apoptosis.
9593687 1998 Caspase-mediated cleavage of the ubiquitin-protein ligase Nedd4 during apoptosis.
9535906 1998 Caspase cleavage of gene products associated with triplet expansion disorders generates truncated fragments containing the polyglutamine tract.
9525868 1998 A single BIR domain of XIAP sufficient for inhibiting caspases.
9384571 1997 The c-IAP-1 and c-IAP-2 proteins are direct inhibitors of specific caspases.
9337844 1997 Caspases: the executioners of apoptosis.
9325343 1997 Cleavage of focal adhesion kinase by caspases during apoptosis.
9323209 1997 Caspase-3-generated fragment of gelsolin: effector of morphological change in apoptosis.
9298992 1997 Caspase cleavage of keratin 18 and reorganization of intermediate filaments during epithelial cell apoptosis.
9230442 1997 X-linked IAP is a direct inhibitor of cell-death proteases.
9228018 1997 FLAME-1, a novel FADD-like anti-apoptotic molecule that regulates Fas/TNFR1-induced apoptosis.
9219695 1997 Alternative cleavage of Alzheimer-associated presenilins during apoptosis by a caspase-3 family protease.
9070923 1997 Identification and mapping of Casp7, a cysteine protease resembling CPP32 beta, interleukin-1 beta converting enzyme, and CED-3.
8962078 1996 Molecular ordering of the Fas-apoptotic pathway: the Fas/APO-1 protease Mch5 is a CrmA-inhibitable protease that activates multiple Ced-3/ICE-like cysteine proteases.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8812467 1996 Chromosomal mapping of cell death proteases CPP32, MCH2, and MCH3.
8780721 1996 Chromosomal localization of the human genes, CPP32, Mch2, Mch3, and Ich-1, involved in cellular apoptosis.
8755496 1996 In vitro activation of CPP32 and Mch3 by Mch4, a novel human apoptotic cysteine protease containing two FADD-like domains.
8631895 1996 Processing and activation of CMH-1 by granzyme B.
8576161 1996 ICE-LAP3, a novel mammalian homologue of the Caenorhabditis elegans cell death protein Ced-3 is activated during Fas- and tumor necrosis factor-induced apoptosis.
8567622 1996 Identification and characterization of CPP32/Mch2 homolog 1, a novel cysteine protease similar to CPP32.
8521391 1995 Mch3, a novel human apoptotic cysteine protease highly related to CPP32.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
7983002 1994 CPP32, a novel human apoptotic protein with homology to Caenorhabditis elegans cell death protein Ced-3 and mammalian interleukin-1 beta-converting enzyme.
1056466 1975 Antibiotic treatment of oral anaerobic infections.