Property Summary

NCBI Gene PubMed Count 48
PubMed Score 92.59
PubTator Score 13.90

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
psoriasis 6685 1.0e-113
lung carcinoma 2844 5.8e-12
ulcerative colitis 2087 5.5e-05
colon cancer 1475 1.7e-03
active Crohn's disease 918 1.6e-02
Disease Target Count Z-score Confidence
Lynch syndrome 35 3.268 1.6

Expression

  Differential Expression (5)

Disease log2 FC p
colon cancer -1.900 1.7e-03
active Crohn's disease 1.402 1.6e-02
lung carcinoma -1.200 5.8e-12
ulcerative colitis 2.400 5.5e-05
psoriasis 5.500 1.0e-113

Gene RIF (37)

PMID Text
26884849 CASP5 gene overexpression significantly promoted angiogenesis ability of HMEC-1 cells, which was probably achieved by inhibiting angpt-1/Tie2 and promoting VEGF-1 signal pathway.
26508369 Caspase-4 and caspase-5 mediate IL-1alpha and IL-1beta release from human monocytes after lipopolysaccharides stimulation.
26173988 both caspase-4 and caspase-5 are functionally important for appropriate responses to intracellular Gram-negative bacteria.
25943872 this study has identified epithelial-expressed caspases-4 and -5 as biomarkers with diagnostic and therapeutic potential in colorectal cancer.
25753570 The distribution of the other genotypes; rs507879, rs518604 and rs523104 of caspase-5) was not significantly different between patients with psoriasis vulgaris and the healthy controls.
22906436 Data show that exposure of hepatocytes to direct hypoxia resulted in acid sphingomyelinase activation and ceramide elevation associated with activation of caspase 5 and the subsequent cleavage of HuR and apoptotic cell death.
21969293 Mutual activation between caspase-5 and -1 suggests caspase-5 may work predominantly in concert with caspase-1 in modulating retinal pigment epithelium inflammatory responses.
21700414 Association of death receptor 4, Caspase 3 and 5 gene polymorphism with increased risk to bladder cancer in North Indians.
21668377 Data suggest a positive association of caspase-3 and diplotype analysis of caspase-5 to be associated with prostate cancer risk.
21454616 analysis of concerted antigen processing of a short viral antigen by human caspase-5 and -10
21191419 Caspase-5 and the inflammasome may have an important role in the inflammatory response in psoriasis.
21051981 The changes of caspase-2 and caspase-5 activities could be indicative of their involvement in the cervical malignancy mechanisms.
20855536 Observational study of gene-disease association. (HuGE Navigator)
20635389 Observational study of gene-disease association. (HuGE Navigator)
20434535 Unfavorable significance of CASP5 heterozygous genotype explained by its role in inflammation-related processes.
20434535 Observational study of gene-disease association. (HuGE Navigator)
20402676 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20237496 Observational study of gene-disease association. (HuGE Navigator)
19773279 Observational study of gene-disease association. (HuGE Navigator)
19604093 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19573080 Observational study of gene-disease association. (HuGE Navigator)
19414860 Observational study of gene-disease association. (HuGE Navigator)
19270026 Single nucleotide polymorphisms in CASP5 and RBBP8 gene are associated with survival in ovarian cancer patients.
19270026 Observational study of gene-disease association. (HuGE Navigator)
19269008 Observational study of gene-disease association. (HuGE Navigator)
19203830 Coding polymorphisms in Casp5, Casp8 and DR4 genes may play a role in predisposition to lung cancer.
19203830 Observational study of gene-disease association. (HuGE Navigator)
19074885 Observational study of gene-disease association. (HuGE Navigator)
18430458 Caspase-5 gene is commonly mutated in the cancers with microsatellite instability suggesting that inactivation of caspase-5 may play a role in their tumorigenesis.
17676485 Alterations in TGF-betaRII, BAX, IGFIIR, caspase-5, hMSH3 and hMSH6 genes of microsatellite instability are rare in urinary bladder carcinoma and they are not associated with microsatellite instability or the presence of p53 mutations.
16893518 novel exon was present in six alternatively spliced caspase-5 mRNA variants expressed in human peripheral blood mononuclear cells (PBMC) and encoded the previously unknown amino-terminus of caspase-5.
16886895 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
15886296 CASPASE-5, an acknowledged frameshift target in MSI+ gastrointestinal tract tumors, was frequently mutated in Microsatellite instability+ cell lines
12964016 Caspase-5 might be a suppressor gene of highly metastatic potential in lung cancer
12479849 Identification of caspase-5 coding region microsatellite mutations in vivo implicates this gene in the pathogenesis of human T-LBL/ALL
12191486 inflammasome comprises caspase-1, caspase-5, Pycard/Asc, and NALP1; a molecular platform triggering activation of inflammatory caspases and processing of proIL-beta

AA Sequence

MAEDSGKKKRRKNFEAMFKGILQSGLDNFVINHMLKNNVAGQTSIQTLVPNTDQKSTSVKKDNHKKKTVK      1 - 70
MLEYLGKDVLHGVFNYLAKHDVLTLKEEEKKKYYDTKIEDKALILVDSLRKNRVAHQMFTQTLLNMDQKI     71 - 140
TSVKPLLQIEAGPPESAESTNILKLCPREEFLRLCKKNHDEIYPIKKREDRRRLALIICNTKFDHLPARN    141 - 210
GAHYDIVGMKRLLQGLGYTVVDEKNLTARDMESVLRAFAARPEHKSSDSTFLVLMSHGILEGICGTAHKK    211 - 280
KKPDVLLYDTIFQIFNNRNCLSLKDKPKVIIVQACRGEKHGELWVRDSPASLALISSQSSENLEADSVCK    281 - 350
IHEEKDFIAFCSSTPHNVSWRDRTRGSIFITELITCFQKYSCCCHLMEIFRKVQKSFEVPQAKAQMPTIE    351 - 420
RATLTRDFYLFPGN                                                            421 - 434
//

Text Mined References (52)

PMID Year Title
26884849 2015 Effects of CASP5 gene overexpression on angiogenesis of HMEC-1 cells.
26508369 2015 Human caspase-4 and caspase-5 regulate the one-step non-canonical inflammasome activation in monocytes.
26173988 2015 NLRP3 inflammasome activation downstream of cytoplasmic LPS recognition by both caspase-4 and caspase-5.
25943872 2015 Altered expression of caspases-4 and -5 during inflammatory bowel disease and colorectal cancer: Diagnostic and therapeutic potential.
25753570 2015 Association of angiopoietin-1, angiopoietin-2 and caspase-5 polymorphisms with psoriasis vulgaris.
22926577 2012 Quantitative proteomic analysis of human substantia nigra in Alzheimer's disease, Huntington's disease and Multiple sclerosis.
22906436 2012 The role of acid sphingomyelinase and caspase 5 in hypoxia-induced HuR cleavage and subsequent apoptosis in hepatocytes.
21969293 2011 Expression and functional roles of caspase-5 in inflammatory responses of human retinal pigment epithelial cells.
21700414 2011 Association of death receptor 4, Caspase 3 and 5 gene polymorphism with increased risk to bladder cancer in North Indians.
21668377 2012 Association of caspases with an increased prostate cancer risk in north Indian population.
21454616 2011 Concerted antigen processing of a short viral antigen by human caspase-5 and -10.
21191419 2011 Caspase-5 expression is upregulated in lesional psoriatic skin.
21051981 2010 Indication of participation of caspase-2 and caspase-5 in mechanisms of human cervical malignancy.
20855536 2010 Germline variation in apoptosis pathway genes and risk of non-Hodgkin's lymphoma.
20635389 2011 Common alleles in candidate susceptibility genes associated with risk and development of epithelial ovarian cancer.
20434535 2010 Evidence for depletion of CASP5 Ala90Thr heterozygous genotype in aged subjects.
20402676 2010 Mutational analysis of caspase genes in prostate carcinomas.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
19773279 2009 Association between genetic variants in VEGF, ERCC3 and occupational benzene haematotoxicity.
19604093 2009 Genetic polymorphisms, their allele combinations and IFN-beta treatment response in Irish multiple sclerosis patients.
19593445 2009 Expression of the Bcl-2 protein BAD promotes prostate cancer growth.
19573080 2009 Common genetic variants in candidate genes and risk of familial lymphoid malignancies.
19414860 2009 Genetic variation in caspase genes and risk of non-Hodgkin lymphoma: a pooled analysis of 3 population-based case-control studies.
19270026 2009 Functional complementation studies identify candidate genes and common genetic variants associated with ovarian cancer survival.
19269008 2009 Mutational analysis of CASP1, 2, 3, 4, 5, 6, 7, 8, 9, 10, and 14 genes in gastrointestinal stromal tumors.
19203830 2009 Coding polymorphisms in Casp5, Casp8 and DR4 genes may play a role in predisposition to lung cancer.
19074885 2008 Genetic variants in apoptosis and immunoregulation-related genes are associated with risk of chronic lymphocytic leukemia.
18430458 2008 Mutational analysis of caspase 1, 4, and 5 genes in common human cancers.
17676485 2007 TGF-betaRII, BAX, IGFIIR, caspase-5, hMSH3 and hMSH6 alterations are not associated with microsatellite instability or p53 mutations in invasive urothelial carcinoma of the urinary bladder.
17431422 2007 The SPRY domain of Pyrin, mutated in familial Mediterranean fever patients, interacts with inflammasome components and inhibits proIL-1beta processing.
17418785 2007 Bcl-2 and Bcl-XL regulate proinflammatory caspase-1 activation by interaction with NALP1.
16893518 2006 Identification of a novel exon encoding the amino-terminus of the predominant caspase-5 variants.
16886895 2006 Genetic predisposition of responsiveness to therapy for chronic hepatitis C.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
15886296 2005 Repeated sequences in CASPASE-5 and FANCD2 but not NF1 are targets for mutation in microsatellite-unstable acute leukemia/myelodysplastic syndrome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12964016 2003 Somatic mutation of the Caspase-5 gene in human lung cancer.
12853457 2003 Characterization of periphilin, a widespread, highly insoluble nuclear protein and potential constituent of the keratinocyte cornified envelope.
12479849 2003 Microsatellite mutations of transforming growth factor-beta receptor type II and caspase-5 occur in human precursor T-cell lymphoblastic lymphomas/leukemias in vivo but are not associated with hMSH2 or hMLH1 promoter methylation.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12191486 2002 The inflammasome: a molecular platform triggering activation of inflammatory caspases and processing of proIL-beta.
11535131 2001 Targeting of the transcription factor Max during apoptosis: phosphorylation-regulated cleavage by caspase-5 at an unusual glutamic acid residue in position P1.
11356849 2001 Effect of mutation and phosphorylation of type I keratins on their caspase-mediated degradation.
10986288 2000 Expression analysis of the human caspase-1 subfamily reveals specific regulation of the CASP5 gene by lipopolysaccharide and interferon-gamma.
10872455 1999 Mammalian caspases: structure, activation, substrates, and functions during apoptosis.
9894612 1998 Calpain activation is upstream of caspases in radiation-induced apoptosis.
9298992 1997 Caspase cleavage of keratin 18 and reorganization of intermediate filaments during epithelial cell apoptosis.
9250871 1997 Interleukin-1beta-converting enzyme (ICE) and related cell death genes ICErel-II and ICErel-III map to the same PAC clone at band 11q22.2-22.3.
8617266 1996 Identification of a cysteine protease closely related to interleukin-1 beta-converting enzyme.
7797592 1995 Molecular cloning and pro-apoptotic activity of ICErelII and ICErelIII, members of the ICE/CED-3 family of cysteine proteases.